Protein Info for Shew_1353 in Shewanella loihica PV-4

Name: flgJ
Annotation: peptidoglycan hydrolase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 341 TIGR02541: flagellar rod assembly protein/muramidase FlgJ" amino acids 11 to 322 (312 residues), 307.4 bits, see alignment E=7.4e-96 PF10135: Rod-binding" amino acids 48 to 98 (51 residues), 53.9 bits, see alignment 2.1e-18 PF01832: Glucosaminidase" amino acids 186 to 323 (138 residues), 115.5 bits, see alignment E=2.6e-37

Best Hits

KEGG orthology group: K02395, flagellar protein FlgJ (inferred from 100% identity to slo:Shew_1353)

Predicted SEED Role

"Flagellar protein FlgJ [peptidoglycan hydrolase] (EC 3.2.1.-)" in subsystem Flagellum (EC 3.2.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.2.1.-

Use Curated BLAST to search for 3.2.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QCM4 at UniProt or InterPro

Protein Sequence (341 amino acids)

>Shew_1353 peptidoglycan hydrolase (RefSeq) (Shewanella loihica PV-4)
MDKLSNASHFLDIGGLDSLRAKAQKDDKAALKEVAQQFEGIFVQMLMKSMRDANAVFESD
SPMNSQYTKFYEQMHDQQMSVNLSDKGMLGLADLMVQQLSPQTSRMTPASVLRGGMVSPV
ANSGQQVDRQSLAQSEAQSKVSSGDKPLPRIFDELVSGKVLPSQAPTGLANKGFESREAF
VKAVYPHAEQAAKVLGTSPEVLIAQSALETGWGQKMVRRADGQPSNNLFNIKADRRWDGE
RAGVSTLEFEHGVAVKQRADFRVYQDIKQSFDDFVSFISEGERYQDAMDKAANPAAFIRG
LQDAGYATDPDYADKVIKVMQAVTQTVAQTVNKQLGAAIGK