Protein Info for Shew_1351 in Shewanella loihica PV-4

Name: flgH
Annotation: flagellar basal body L-ring protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 234 signal peptide" amino acids 1 to 32 (32 residues), see Phobius details PF02107: FlgH" amino acids 54 to 233 (180 residues), 203 bits, see alignment E=1.4e-64

Best Hits

Swiss-Prot: 83% identical to FLGH_SHESR: Flagellar L-ring protein (flgH) from Shewanella sp. (strain MR-7)

KEGG orthology group: K02393, flagellar L-ring protein precursor FlgH (inferred from 100% identity to slo:Shew_1351)

Predicted SEED Role

"Flagellar L-ring protein FlgH" in subsystem Flagellar motility or Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QCM2 at UniProt or InterPro

Protein Sequence (234 amino acids)

>Shew_1351 flagellar basal body L-ring protein (RefSeq) (Shewanella loihica PV-4)
MTKFVMAKFVMAKSSVLVVALALVGCASTNQKPIADDPYYAPVYPEAPPTKIAATGSMYQ
DSQASSLYSDIKALKVGDIITVILQESTKAKKSANNELKKGSDLTLDPIYAGGGNVTISG
SPIDLRYKDSMNTKRESDADQSNSLSGSISANVMQVLNNGNLVIRGEKWITINNGDEFVR
LTGIVRSQDIRPDNTIDSQRVANARIQYSGTGTFADAQKVGWLSQFFMSDWWPF