Protein Info for Shew_1342 in Shewanella loihica PV-4

Name: flgA
Annotation: flagellar basal body P-ring biosynthesis protein FlgA (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 235 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details PF17656: ChapFlgA_N" amino acids 37 to 111 (75 residues), 54.1 bits, see alignment E=2.4e-18 TIGR03170: flagella basal body P-ring formation protein FlgA" amino acids 101 to 233 (133 residues), 132.4 bits, see alignment E=5.3e-43 PF13144: ChapFlgA" amino acids 114 to 233 (120 residues), 115 bits, see alignment E=3.3e-37 PF08666: SAF" amino acids 114 to 175 (62 residues), 32.8 bits, see alignment E=1.2e-11

Best Hits

KEGG orthology group: K02386, flagella basal body P-ring formation protein FlgA (inferred from 100% identity to slo:Shew_1342)

Predicted SEED Role

"Flagellar basal-body P-ring formation protein FlgA" in subsystem Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QCL3 at UniProt or InterPro

Protein Sequence (235 amino acids)

>Shew_1342 flagellar basal body P-ring biosynthesis protein FlgA (RefSeq) (Shewanella loihica PV-4)
MKVNFAYFLFLLLISLPLKAAETTSVPSVSTIARLATEAVQEKMAFPQDAKVIITPQSLD
TRLNPPACLGEPKAEIASDRAISKNNTVKISCASPDLDYPWQIYISVRVEVLFPVVVANQ
TLGPGDLIESDQIRLDYVEQSQLRGQQFDDPVAVTGTRVKRRIPANQPLFASNLCFVCKG
DIVAIYARADNFVIKTNGEALKDGNLGDKIQVRNSRSNKTVDAHVTGIGEVEVRM