Protein Info for Shew_1303 in Shewanella loihica PV-4

Annotation: cytochrome d ubiquinol oxidase, subunit II (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 379 transmembrane" amino acids 12 to 39 (28 residues), see Phobius details amino acids 60 to 79 (20 residues), see Phobius details amino acids 84 to 101 (18 residues), see Phobius details amino acids 119 to 141 (23 residues), see Phobius details amino acids 161 to 182 (22 residues), see Phobius details amino acids 202 to 223 (22 residues), see Phobius details amino acids 264 to 282 (19 residues), see Phobius details amino acids 290 to 315 (26 residues), see Phobius details amino acids 335 to 360 (26 residues), see Phobius details TIGR00203: cytochrome d ubiquinol oxidase, subunit II" amino acids 1 to 379 (379 residues), 583 bits, see alignment E=1.5e-179 PF02322: Cyt_bd_oxida_II" amino acids 7 to 361 (355 residues), 366.9 bits, see alignment E=4.3e-114

Best Hits

Swiss-Prot: 67% identical to CYDB_ECO57: Cytochrome bd-I ubiquinol oxidase subunit 2 (cydB) from Escherichia coli O157:H7

KEGG orthology group: K00426, cytochrome bd-I oxidase subunit II [EC: 1.10.3.-] (inferred from 100% identity to slo:Shew_1303)

MetaCyc: 67% identical to cytochrome bd-I subunit 2 (Escherichia coli K-12 substr. MG1655)
RXN0-5266 [EC: 7.1.1.7]; 1.11.1.- [EC: 7.1.1.7]; 1.11.1.- [EC: 7.1.1.7]

Predicted SEED Role

"Cytochrome d ubiquinol oxidase subunit II (EC 1.10.3.-)" in subsystem Bacterial RNA-metabolizing Zn-dependent hydrolases or Conserved gene cluster associated with Met-tRNA formyltransferase or Terminal cytochrome d ubiquinol oxidases or Terminal cytochrome oxidases (EC 1.10.3.-)

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 1.10.3.-

Use Curated BLAST to search for 1.10.3.- or 7.1.1.7

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QCH5 at UniProt or InterPro

Protein Sequence (379 amino acids)

>Shew_1303 cytochrome d ubiquinol oxidase, subunit II (RefSeq) (Shewanella loihica PV-4)
MFDYEILRFVWWALIGVLFIGFAVTDGFDMGVGALLPIIGKDDTERRIMINSIAPHWDGN
QVWLITAGGALFAAWPMVYAVSFSGFYVAMMLVLFALFLRPVGFDYRSKIEDPRWRKAWD
WALFVGGFVPPLIIGVAFGNLLQGVPFNFDEYLRATYHGGLFGLLNPFGLLAGLVSVSMI
IMQGASWLQMKTEGELRVRAATATQVAAALVAVLFTLAGVWLANGIDGYVVTSTIDTHGA
SNPALKTVAVEAGAWLANYDKYPVTMLFPILGIAMPVLALLASRFNRSGFAFLFSSLAVA
MVILTCGAAMFPFVMPSSLEPNVSLTMWDATASHMTLTVMTWAAAIFVPIVLSYTIWTYF
KMFGRLSRSYIEDNKTSLY