Protein Info for Shew_1297 in Shewanella loihica PV-4

Annotation: inositol-5-monophosphate dehydrogenase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 488 PF00478: IMPDH" amino acids 8 to 473 (466 residues), 536.2 bits, see alignment E=6.4e-165 TIGR01302: inosine-5'-monophosphate dehydrogenase" amino acids 8 to 454 (447 residues), 642 bits, see alignment E=2.6e-197 PF00571: CBS" amino acids 96 to 140 (45 residues), 38.4 bits, see alignment 2.6e-13 amino acids 149 to 204 (56 residues), 38.6 bits, see alignment 2.2e-13 PF01070: FMN_dh" amino acids 274 to 365 (92 residues), 32 bits, see alignment E=1.4e-11

Best Hits

Swiss-Prot: 78% identical to IMDH_HAEIN: Inosine-5'-monophosphate dehydrogenase (guaB) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: K00088, IMP dehydrogenase [EC: 1.1.1.205] (inferred from 100% identity to slo:Shew_1297)

MetaCyc: 78% identical to inosine 5'-monophosphate dehydrogenase (Escherichia coli K-12 substr. MG1655)
IMP dehydrogenase. [EC: 1.1.1.205]

Predicted SEED Role

"Inosine-5'-monophosphate dehydrogenase (EC 1.1.1.205) / CBS domain" in subsystem Purine conversions (EC 1.1.1.205)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.205

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QCG9 at UniProt or InterPro

Protein Sequence (488 amino acids)

>Shew_1297 inositol-5-monophosphate dehydrogenase (RefSeq) (Shewanella loihica PV-4)
MLRLKKEALTFDDVLLVPAHSTVLPNTAVLKTRLTQKIELNMPIVSAAMDTVTEARLAIA
MAQEGGIGFIHKNMSIEQQAEQVRQVKIYEAGIVQQPVTVTPNTTLEQLKVLTEKNGFAG
YPVVDEANELVGIITGRDVRFITDWSRTVDQVMTPKERLVTVPEGTPLDEVQKLMHAHRV
EKVLVVDGDFRLKGLITVKDFQKAEEKPNACKDELGRLRVGAAVGAGAGNEARVDALVKA
GIDVLLIDSSHGHSEGVLQRIRDTRAKYPDLQIVGGNVATAEGALALVEAGVNAVKVGIG
PGSICTTRIVTGVGVPQITAVSDAAAAVKHLDIPVIADGGIRFSGDLAKALAAGASCIMA
GSMFAGTDEAPGETELYNGRAYKSYRGMGSLGAMTQGSSDRYFQSDNAADKLVPEGIEGR
VPYKGKLKEIIHQYMGGLRSCMGLTGCPTIKDLNEKAEFVKVTSAGMGESHVHDVTISKE
APNYRSRS