Protein Info for Shew_1288 in Shewanella loihica PV-4

Annotation: type IV pilus biogenesis/stability protein PilW (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 262 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details TIGR02521: type IV pilus biogenesis/stability protein PilW" amino acids 12 to 249 (238 residues), 270.6 bits, see alignment E=5.5e-85 PF13181: TPR_8" amino acids 50 to 78 (29 residues), 18.4 bits, see alignment (E = 1e-06) amino acids 150 to 181 (32 residues), 15.4 bits, see alignment 9.4e-06 PF13374: TPR_10" amino acids 115 to 143 (29 residues), 21.1 bits, see alignment (E = 1.3e-07) PF13424: TPR_12" amino acids 116 to 178 (63 residues), 34.7 bits, see alignment E=9.3e-12 PF07719: TPR_2" amino acids 152 to 182 (31 residues), 24.1 bits, see alignment 1.5e-08 PF13176: TPR_7" amino acids 153 to 182 (30 residues), 15.8 bits, see alignment 6.8e-06 PF14559: TPR_19" amino acids 162 to 217 (56 residues), 27.3 bits, see alignment E=2.1e-09

Best Hits

KEGG orthology group: K02656, type IV pilus assembly protein PilF (inferred from 100% identity to slo:Shew_1288)

Predicted SEED Role

"Type IV pilus biogenesis protein PilF"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QCG0 at UniProt or InterPro

Protein Sequence (262 amino acids)

>Shew_1288 type IV pilus biogenesis/stability protein PilW (RefSeq) (Shewanella loihica PV-4)
MLSKKPTLTLLVILTSALMSGCVTERTYSGTDVPVQERTFDNVSAARQRVQLGLTYLQKG
NSEQAKYNLDKALEFAPNIEDVHVALAYYYQSVGELELTEKAYRNAINASDASGDSMNNF
GVFLCQQAKYDQAEEMFLRAVKMPKYTRSASSYENLGICSRKSGDLQKAQRYFEMALNYD
PRRANSLLELSEIELDLGNYSAAKKGLARYHRVVPESAQSLALGIKIEQGLNDPEAMRKF
GILLLAKFPASNEAKQYRASMH