Protein Info for Shew_1247 in Shewanella loihica PV-4

Annotation: hypothetical protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 310 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details transmembrane" amino acids 30 to 50 (21 residues), see Phobius details amino acids 61 to 82 (22 residues), see Phobius details amino acids 95 to 109 (15 residues), see Phobius details amino acids 121 to 142 (22 residues), see Phobius details amino acids 154 to 177 (24 residues), see Phobius details amino acids 187 to 208 (22 residues), see Phobius details amino acids 220 to 241 (22 residues), see Phobius details amino acids 250 to 272 (23 residues), see Phobius details amino acids 284 to 307 (24 residues), see Phobius details PF05982: Sbt_1" amino acids 6 to 303 (298 residues), 366 bits, see alignment E=8.7e-114

Best Hits

KEGG orthology group: K07086, (no description) (inferred from 100% identity to slo:Shew_1247)

Predicted SEED Role

"putative sodium-dependent bicarbonate transporter" in subsystem CO2 uptake, carboxysome

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QCB9 at UniProt or InterPro

Protein Sequence (310 amino acids)

>Shew_1247 hypothetical protein (RefSeq) (Shewanella loihica PV-4)
MQLDITIAFFILGALATLIRSDIQFPKALYQSLTLFLMLAIGLKGGVALSKYGSMALLPQ
SLLVIGMGLIIPLIAFPILRYIGQLKLEDAASIAAHYGSVSIGTYAVAVAFLEAQGISYE
AYFPLFVVLLEIPAIAVGIALARRSGTNLKWRTLIHEVFCNQSLVLLVGALIIGYFWAER
IEGVTPLFFNLFHGVLALFLLEMGMLAASRLKELKQMGNFMLAFGVFMPLIGGLLGSILG
LQMGLSSGGATLLAVLGASASYIAVPAAMRVAIPEANQSLSITYSLAITFPFNVLVGIPT
YALFTYWLSN