Protein Info for Shew_1215 in Shewanella loihica PV-4

Name: recA
Annotation: recombinase A (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 353 TIGR02012: protein RecA" amino acids 6 to 325 (320 residues), 557.5 bits, see alignment E=5e-172 PF00154: RecA_N" amino acids 9 to 270 (262 residues), 470.7 bits, see alignment E=3.2e-145 PF08423: Rad51" amino acids 38 to 229 (192 residues), 36.4 bits, see alignment E=9e-13 PF06745: ATPase" amino acids 42 to 198 (157 residues), 28.7 bits, see alignment E=2.2e-10 PF27531: MT3502_N" amino acids 54 to 153 (100 residues), 30.5 bits, see alignment E=9.7e-11 PF21096: RecA_C" amino acids 273 to 327 (55 residues), 80.8 bits, see alignment 1.5e-26

Best Hits

Swiss-Prot: 100% identical to RECA_SHELP: Protein RecA (recA) from Shewanella loihica (strain ATCC BAA-1088 / PV-4)

KEGG orthology group: K03553, recombination protein RecA (inferred from 100% identity to slo:Shew_1215)

MetaCyc: 83% identical to DNA recombination/repair protein RecA (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"RecA protein" in subsystem DNA-replication or DNA repair, bacterial or DNA repair, bacterial RecFOR pathway

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QC87 at UniProt or InterPro

Protein Sequence (353 amino acids)

>Shew_1215 recombinase A (RefSeq) (Shewanella loihica PV-4)
MKIDANKEKALSAVLGQIEKQFGKGSIMKLGENRSMDVETISTGSLSLDVALGAGGLPLG
RIVEIYGPESSGKTTLTLEVIAAAQREGKVCAFIDAEHALDPIYAQKLGVDIDNLLCSQP
DTGEQALEICDALTRSGAVDVIIVDSVAALTPKAEIEGEIGDSHMGLAARMMSQAMRKLA
GNLKQSNTLLIFINQIRMKIGVMFGNPETTTGGNALKFYASVRLDIRRTGAIKDREEVIG
NETRVKVVKNKIAAPFKQAEFQILYGEGINRTGELVDLGVMHKLIEKSGAWYSYKGDKIG
QGRANAGKYLVENPEIGAEIDQALRAMLLGGGQAVAQSATGDENVDLETGEVF