Protein Info for Shew_1211 in Shewanella loihica PV-4

Annotation: protein-L-isoaspartate O-methyltransferase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 216 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details PF01135: PCMT" amino acids 17 to 214 (198 residues), 219.9 bits, see alignment E=3.2e-69 TIGR00080: protein-L-isoaspartate O-methyltransferase" amino acids 26 to 215 (190 residues), 245.4 bits, see alignment E=2.7e-77 PF13649: Methyltransf_25" amino acids 87 to 167 (81 residues), 27.2 bits, see alignment E=5.2e-10

Best Hits

Swiss-Prot: 100% identical to PIMT_SHELP: Protein-L-isoaspartate O-methyltransferase (pcm) from Shewanella loihica (strain ATCC BAA-1088 / PV-4)

KEGG orthology group: K00573, protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC: 2.1.1.77] (inferred from 100% identity to slo:Shew_1211)

MetaCyc: 63% identical to protein-L-isoaspartate O-methyltransferase (Escherichia coli K-12 substr. MG1655)
Protein-L-isoaspartate(D-aspartate) O-methyltransferase. [EC: 2.1.1.77]

Predicted SEED Role

"Protein-L-isoaspartate O-methyltransferase (EC 2.1.1.77)" in subsystem Ton and Tol transport systems (EC 2.1.1.77)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.1.1.77

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QC83 at UniProt or InterPro

Protein Sequence (216 amino acids)

>Shew_1211 protein-L-isoaspartate O-methyltransferase (RefSeq) (Shewanella loihica PV-4)
MDRAIMNGVATTAALNLARHLQGAGITNAEVLAVVAKTPRELFLDAALGHKAYENTALPI
GQGQTISQPYIVARMTELLLESRPKRVLEIGTGSGYQAAILAQLVDELCTVERIKSLQIQ
ARQRLKRLDLHNVSFKYGDGWQGWANKGPFDAIMVTAAASSVPQALLQQLADGGVLVIPV
GEETQQLMRVVRMGDQFHSQTIEMVKFVPLVNGELA