Protein Info for Shew_1190 in Shewanella loihica PV-4

Annotation: riboflavin synthase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 158 PF00885: DMRL_synthase" amino acids 13 to 151 (139 residues), 188 bits, see alignment E=3.8e-60 TIGR00114: 6,7-dimethyl-8-ribityllumazine synthase" amino acids 14 to 150 (137 residues), 177.7 bits, see alignment E=6e-57

Best Hits

Swiss-Prot: 100% identical to RISB_SHELP: 6,7-dimethyl-8-ribityllumazine synthase (ribH) from Shewanella loihica (strain ATCC BAA-1088 / PV-4)

KEGG orthology group: K00794, 6,7-dimethyl-8-ribityllumazine synthase [EC: 2.5.1.78] (inferred from 94% identity to shn:Shewana3_1099)

MetaCyc: 62% identical to 6,7-dimethyl-8-ribityllumazine synthase (Escherichia coli K-12 substr. MG1655)
LUMAZINESYN-RXN [EC: 2.5.1.78]

Predicted SEED Role

"6,7-dimethyl-8-ribityllumazine synthase (EC 2.5.1.78)" (EC 2.5.1.78)

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.5.1.78

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QC62 at UniProt or InterPro

Protein Sequence (158 amino acids)

>Shew_1190 riboflavin synthase (RefSeq) (Shewanella loihica PV-4)
MNVVQGNIESKNAKVAIVVSRFNSFVVESLLEGAVDTLKRFGQVADDNITVVRVPGAVEL
PLAARRVAASGKFDGIIALGAVIRGGTPHFDFVAGECNKGLAQIALEFDLPVSFGVLTTD
TIEQAIERSGTKAGNKGGEAALGLLEMVNVLQELEQQL