Protein Info for Shew_1177 in Shewanella loihica PV-4

Annotation: RND family efflux transporter MFP subunit (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 417 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details TIGR01730: efflux transporter, RND family, MFP subunit" amino acids 69 to 370 (302 residues), 280.4 bits, see alignment E=8.3e-88 PF16576: HlyD_D23" amino acids 76 to 290 (215 residues), 105.7 bits, see alignment E=4.2e-34 PF13533: Biotin_lipoyl_2" amino acids 91 to 137 (47 residues), 35.3 bits, see alignment 1.5e-12 PF13437: HlyD_3" amino acids 187 to 288 (102 residues), 47.4 bits, see alignment E=5.7e-16

Best Hits

KEGG orthology group: None (inferred from 100% identity to slo:Shew_1177)

Predicted SEED Role

"Membrane fusion protein of RND family multidrug efflux pump" in subsystem Multidrug Resistance Efflux Pumps

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QC49 at UniProt or InterPro

Protein Sequence (417 amino acids)

>Shew_1177 RND family efflux transporter MFP subunit (RefSeq) (Shewanella loihica PV-4)
MDKKYLYIPLGVLALAALLTFAVAANQAKSQSPTYQPQVVKGKAANGKAANANTANVKAG
ARAVPIASARVEAHEVAQHLSLVGKLAANRSVQIAAEVSGKVQAINLSDNQAVSQGQVLV
HLEDAKAKANLAEAKAYLNDERRKLGEYKRLIKQHAITQTEIDAQLASVDIAEARLQAAQ
ADLDYHTLKAPFDGVIGLVDFSLGKLVSVGSELVSLDDLSSMRLDLQIPERYLSQIYLGM
PVVASSSAWPGEQFHGQVVAMAPRINSETLNLKVRVNFDNPSLQLRPGMLISARLDFAPV
TQAVVPVQALEYSGTKRFVYVIDSDNIARRTQVTLGARIDDQVLIDDGLSLGDRIVVKGL
VNMRDGIKVEDVETGQLAEGLGGRRLTQTQTQTQTQVQTQVQTQVQTGETETARGQS