Protein Info for Shew_1174 in Shewanella loihica PV-4

Annotation: sulfotransferase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 531 PF13432: TPR_16" amino acids 8 to 67 (60 residues), 25.1 bits, see alignment E=7.9e-09 amino acids 110 to 172 (63 residues), 26.7 bits, see alignment E=2.5e-09 PF13181: TPR_8" amino acids 39 to 64 (26 residues), 13.4 bits, see alignment (E = 2.9e-05) amino acids 140 to 172 (33 residues), 19.1 bits, see alignment (E = 4.5e-07) PF13469: Sulfotransfer_3" amino acids 278 to 471 (194 residues), 127.2 bits, see alignment E=4.6e-40 PF00685: Sulfotransfer_1" amino acids 278 to 472 (195 residues), 42 bits, see alignment E=3.1e-14

Best Hits

KEGG orthology group: None (inferred from 100% identity to slo:Shew_1174)

Predicted SEED Role

"TPR domain protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QC46 at UniProt or InterPro

Protein Sequence (531 amino acids)

>Shew_1174 sulfotransferase (RefSeq) (Shewanella loihica PV-4)
MSREARYLEEARGFYQSGKFSSAGIYARKVIRREPSNGEAQALLGHLAFRSGEHQEAMSC
YLKAQAAGFQDQELRLNLVTLHERREAFFDAVNLLRELVEETPQDLSLQLRLGINASRTG
DMTTAESALLAALAGDEQAAQASLNLGHVYKAKGDTDKAAAFYHDYIRLAPSQQATAYWS
LADLKNYRFTEQDEAALKANIAAEEFSQASQSLFHFALNRVYEQRKQGEQAFDAVRMANQ
LMRPLRPFKREAFTRLVDSLKSAEVKPRGEETSGPWTPIFIVGMPRSGTTLCEQILASHS
QIAATDELPFMERLALSLEMKGGYGAMLPRLSEEQIAQMRQQYIEQVNQYLKAQGEASPS
LVPSLVIDKNPNNFIHIGLIKTLFPEAKIINVIRDARDNAMGVYKQHFSHGHDYSYHLDD
ICHYWQLYLELMAHWQQAYGDSLYHLCFEQLVKAPDQQIPAMVDYVGLALEPACLKFYES
KRSVLTPSASQVRRPMNVKAIGQSEAYAAFIPNAYRTLTVIADRAHKSFLS