Protein Info for Shew_1152 in Shewanella loihica PV-4

Annotation: MscS mechanosensitive ion channel (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 274 transmembrane" amino acids 15 to 36 (22 residues), see Phobius details amino acids 56 to 78 (23 residues), see Phobius details amino acids 86 to 109 (24 residues), see Phobius details PF05552: MS_channel_1st_1" amino acids 13 to 55 (43 residues), 43.8 bits, see alignment 3.8e-15 PF21088: MS_channel_1st" amino acids 67 to 103 (37 residues), 26.7 bits, see alignment 9.2e-10 PF00924: MS_channel_2nd" amino acids 105 to 170 (66 residues), 78 bits, see alignment E=9.3e-26 PF21082: MS_channel_3rd" amino acids 177 to 259 (83 residues), 72.8 bits, see alignment E=5e-24

Best Hits

Swiss-Prot: 50% identical to MSCS_EDWI9: Small-conductance mechanosensitive channel (mscS) from Edwardsiella ictaluri (strain 93-146)

KEGG orthology group: K03442, small conductance mechanosensitive channel (inferred from 100% identity to slo:Shew_1152)

MetaCyc: 48% identical to small conductance mechanosensitive channel MscS (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-86

Predicted SEED Role

"Mechanosensitive ion channel"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QC25 at UniProt or InterPro

Protein Sequence (274 amino acids)

>Shew_1152 MscS mechanosensitive ion channel (RefSeq) (Shewanella loihica PV-4)
MENLDKYIEQAPELILTYGLQVVFAIIIFIIGKYLANVAKKLTTKLMNKRKIDKTVVSFV
ANMAWALVFVFTVIATLGQIGVQTASLVAVIGAAGLAVGLALQGSLSNFASGVLMVLFRP
CRVGDYIEAAGIAGTVDEITIFSTKLRTPDNKVIVAPNSSIMNGTITNYSAMETRRIDLV
IGVSYDADLKQTKEVLKQVLDNNAYILKDPAYTVALTELADSSVNFVVRPWVKGSDYWPA
RFEILEQIKLALDENNIGIPYPQMDIYVKETPAA