Protein Info for Shew_1139 in Shewanella loihica PV-4

Annotation: twitching motility protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 370 TIGR01420: twitching motility protein" amino acids 6 to 344 (339 residues), 434.2 bits, see alignment E=1.9e-134 PF00437: T2SSE" amino acids 114 to 282 (169 residues), 146.7 bits, see alignment E=3.8e-47

Best Hits

KEGG orthology group: K02670, twitching motility protein PilU (inferred from 100% identity to slo:Shew_1139)

Predicted SEED Role

"Twitching motility protein PilT" in subsystem Type IV pilus

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QC12 at UniProt or InterPro

Protein Sequence (370 amino acids)

>Shew_1139 twitching motility protein (RefSeq) (Shewanella loihica PV-4)
MEVRPFLKVMVERKASDLFITAGFPPSAKVDGEVRPLAENPFTPAQSLEFVEALMTEAQR
KEFHETRECNFAYGEKGLGRFRVSAFWQRESPGCVMRRIETKIPLVEDLKLPPILKDLVM
SKRGLIIMVGGTGTGKSTSLAALVGYRNSHARGHILTIEDPVEFVHDHRKSIITQREVGI
DTDSFDAALKSSLRQAPDVILIGEIRTQETMEFALSFAETGHLCMATLHANNANQALDRI
MHLVPESKHQQLLFDLSLNLRGIVAQQLVPKADGTGRRAAIEVLINTPRVASIIQKNELH
LLKETMAKSNEQGMQTFDQALLKLYVEGEISYSDALHHADSPNDLRLMIKLQSSESASSG
FMEGVTLDLD