Protein Info for Shew_1137 in Shewanella loihica PV-4

Annotation: alanine racemase domain-containing protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 233 TIGR00044: pyridoxal phosphate enzyme, YggS family" amino acids 1 to 228 (228 residues), 282.8 bits, see alignment E=1.1e-88 PF01168: Ala_racemase_N" amino acids 28 to 228 (201 residues), 91.4 bits, see alignment E=3.7e-30

Best Hits

Swiss-Prot: 60% identical to PLPHP_PASMU: Pyridoxal phosphate homeostasis protein (PM0112) from Pasteurella multocida (strain Pm70)

KEGG orthology group: K06997, (no description) (inferred from 100% identity to slo:Shew_1137)

Predicted SEED Role

"Hypothetical protein YggS, proline synthase co-transcribed bacterial homolog PROSC"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QC10 at UniProt or InterPro

Protein Sequence (233 amino acids)

>Shew_1137 alanine racemase domain-containing protein (RefSeq) (Shewanella loihica PV-4)
MTTIADRLADAHQRIAQAAQNSSRDSREIQLLAVSKTKPIDQIVAAYDAGQRLFGENYVQ
EGEEKINALRESHGDIEWHFIGPLQSNKTKSIAEHFDWMHTLSREKIAKRLSEQRPSHLA
PLQVCIQVNVSQEQSKSGVNPDEVAHLAEIIASLPRLTLRGLMAIPTATDDVALQQAEFS
QMQALFEALKQQHPSLDTLSMGMSQDLEQAIAAGSTMVRIGSAIFGARDYAKA