Protein Info for Shew_1136 in Shewanella loihica PV-4

Updated annotation (from data): pyrroline-5-carboxylate reductase (EC 1.5.1.2)
Rationale: Important for fitness in most defined media. Semi-automated annotation based on the auxotrophic phenotype and a hit to HMM TIGR00112.
Original annotation: pyrroline-5-carboxylate reductase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 272 PF03807: F420_oxidored" amino acids 5 to 99 (95 residues), 74.7 bits, see alignment E=1.1e-24 TIGR00112: pyrroline-5-carboxylate reductase" amino acids 6 to 268 (263 residues), 247.5 bits, see alignment E=9.3e-78 PF01210: NAD_Gly3P_dh_N" amino acids 41 to 105 (65 residues), 23.3 bits, see alignment E=8.2e-09 PF14748: P5CR_dimer" amino acids 163 to 268 (106 residues), 119.1 bits, see alignment E=1.5e-38

Best Hits

Swiss-Prot: 52% identical to P5CR_VIBAL: Pyrroline-5-carboxylate reductase (proC) from Vibrio alginolyticus

KEGG orthology group: K00286, pyrroline-5-carboxylate reductase [EC: 1.5.1.2] (inferred from 100% identity to slo:Shew_1136)

MetaCyc: 35% identical to ProC (Acetoanaerobium sticklandii)
Pyrroline-5-carboxylate reductase. [EC: 1.5.1.2]

Predicted SEED Role

"Pyrroline-5-carboxylate reductase (EC 1.5.1.2)" in subsystem Proline Synthesis (EC 1.5.1.2)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.5.1.2

Use Curated BLAST to search for 1.5.1.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QC09 at UniProt or InterPro

Protein Sequence (272 amino acids)

>Shew_1136 pyrroline-5-carboxylate reductase (EC 1.5.1.2) (Shewanella loihica PV-4)
MTQKKICFIGAGNMTRSITSGLVKGGYAPELIHATNPSEGKLIALKQDLGIRVSHDNLQA
ADEADVIVLAVKPQLMQQVCEAMSGLNLKDKLIVTIAAGVTAERYHAFFKQPIQLIRTMP
NTPTQIGLGMTGLYAEQGVSAQDRELCEQLMQTGGETVWVEKEEDLNQVIALAGSSPAYF
FLMMEAMIDSAKQDGVDEQTAREMVQQAALGAAAMVKQNPQLSPAQLRENVTSKGGTTAQ
ALAAFERAGLREIVRTAMHDCMDRAQEMAKQF