Protein Info for Shew_1100 in Shewanella loihica PV-4

Annotation: lipoprotein signal peptidase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 170 transmembrane" amino acids 12 to 31 (20 residues), see Phobius details amino acids 43 to 58 (16 residues), see Phobius details amino acids 67 to 87 (21 residues), see Phobius details amino acids 94 to 113 (20 residues), see Phobius details amino acids 133 to 153 (21 residues), see Phobius details TIGR00077: signal peptidase II" amino acids 7 to 162 (156 residues), 171 bits, see alignment E=9.8e-55 PF01252: Peptidase_A8" amino acids 15 to 156 (142 residues), 153.7 bits, see alignment E=1.9e-49

Best Hits

Swiss-Prot: 100% identical to LSPA_SHELP: Lipoprotein signal peptidase (lspA) from Shewanella loihica (strain ATCC BAA-1088 / PV-4)

KEGG orthology group: K03101, signal peptidase II [EC: 3.4.23.36] (inferred from 100% identity to slo:Shew_1100)

MetaCyc: 53% identical to lipoprotein signal peptidase (Escherichia coli K-12 substr. MG1655)
Signal peptidase II. [EC: 3.4.23.36]

Predicted SEED Role

"Lipoprotein signal peptidase (EC 3.4.23.36)" in subsystem Sex pheromones in Enterococcus faecalis and other Firmicutes or Signal peptidase (EC 3.4.23.36)

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.4.23.36

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QBX3 at UniProt or InterPro

Protein Sequence (170 amino acids)

>Shew_1100 lipoprotein signal peptidase (RefSeq) (Shewanella loihica PV-4)
MPSSWKESGLRWYWVVVLVFVADQLSKQWVLANFDLRESINLLPFFNFTYVRNYGAAFSF
LNDAGGWQRWLFTLVAVGFSTLLTVWLRKQPKGLWRLNLAYTLVIGGALGNLIDRLQHGF
VVDFLDFYWKTSHFPAFNIADSAICVGAGLIILDSFISERKPNGEDVAKG