Protein Info for Shew_1095 in Shewanella loihica PV-4

Annotation: ArsR family transcriptional regulator (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 75 98 PF12840: HTH_20" amino acids 20 to 70 (51 residues), 31.8 bits, see alignment E=2.1e-11 PF01022: HTH_5" amino acids 23 to 68 (46 residues), 53.2 bits, see alignment E=4.2e-18 PF13601: HTH_34" amino acids 25 to 74 (50 residues), 27.3 bits, see alignment E=6.5e-10

Best Hits

Swiss-Prot: 64% identical to HLYU_VIBCH: Transcriptional activator HlyU (hlyU) from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

KEGG orthology group: None (inferred from 100% identity to slo:Shew_1095)

Predicted SEED Role

"Transcriptional activator HlyU"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QBW8 at UniProt or InterPro

Protein Sequence (98 amino acids)

>Shew_1095 ArsR family transcriptional regulator (RefSeq) (Shewanella loihica PV-4)
MNIELMQQRADNAVVLLKALANERRLFILCYLLSEGEMCVGEMNKKLGLSQSALSQHLAW
LRKDNLVETRKEAQTVFYSLKSKEVSEIIKLLNTIYCH