Protein Info for Shew_1084 in Shewanella loihica PV-4

Annotation: PAS/PAC sensor hybrid histidine kinase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 678 TIGR00229: PAS domain S-box protein" amino acids 169 to 290 (122 residues), 36.6 bits, see alignment E=2.3e-13 PF00989: PAS" amino acids 170 to 265 (96 residues), 28 bits, see alignment E=4.8e-10 PF13426: PAS_9" amino acids 180 to 284 (105 residues), 47.5 bits, see alignment E=4.7e-16 PF00512: HisKA" amino acids 301 to 364 (64 residues), 39.6 bits, see alignment E=1.1e-13 PF02518: HATPase_c" amino acids 407 to 529 (123 residues), 65.7 bits, see alignment E=1.3e-21 PF00072: Response_reg" amino acids 555 to 661 (107 residues), 43.9 bits, see alignment E=5.9e-15

Best Hits

KEGG orthology group: None (inferred from 100% identity to slo:Shew_1084)

Predicted SEED Role

"Histidine kinase/response regulator hybrid protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QBV7 at UniProt or InterPro

Protein Sequence (678 amino acids)

>Shew_1084 PAS/PAC sensor hybrid histidine kinase (RefSeq) (Shewanella loihica PV-4)
MDSSVFKDLSQSEFMDFGPALIAQLGKLQGQFIRGDDVLLPLCRILADSSGAESVMILSR
RLLASDEMPADVTCWCRDSMRYITLWRQVKDWPLLDGQRGAHQWQRFVVWPIEGLDVNIF
FYRPGKGWLSFLTSYQTFIADSISGMLLQQSQDWQQSRNAQIIKSIDTQMYQSIVSNSED
MIVVASRQKGMAPVIMYANAAATAISQYPRSQLIGKSIELFFGDQDDKALELLEAIELRL
EFTGELVCSTATGEKVILHTHLIALNEQYEDGSLFTLVGRDITEQKLMQNTMARTQKMQA
MGQLVGGVAHDFNNILGVLKGNLELMELKGKDESIARYLATALKACQRGTDLTRRLLQFS
RQEQFSAQPVQVNEVLQSLEELLEKSLTTQVSLNIQPQPSMRDICVDRGDLEDALINLVL
NAKDAMHGEGQITIVTGEQYLSGYLPGVGNTVSTDNRDYVWVSVIDQGGGIPDNLLDKIF
EPFFTTKDKSKGTGLGLSMVYGFVKRSNGYMSIMRTGADGTEIRLWFPAIKPVERQIERQ
HSPLEYPKVAHPIKVLIVDDEPDLLEVLCDYCQMMGMEVLAYTDPLLVKEQFKDGIDNID
LIISDLLMPGGINGYELVTDLSVHRTIPVLLISGYVGDVGISSREDLPFQVLQKPFDIRA
FVRGLEEIGIEFVQGELR