Protein Info for Shew_1073 in Shewanella loihica PV-4

Annotation: sigma 54 modulation protein/ribosomal protein S30EA (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 124 PF02482: Ribosomal_S30AE" amino acids 2 to 90 (89 residues), 70.4 bits, see alignment E=9e-24 TIGR00741: ribosomal subunit interface protein" amino acids 2 to 92 (91 residues), 75.5 bits, see alignment E=2e-25

Best Hits

KEGG orthology group: K05809, ribosome-associated inhibitor A (inferred from 100% identity to slo:Shew_1073)

Predicted SEED Role

"Ribosome hibernation protein YfiA" in subsystem Ribosome activity modulation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QBU6 at UniProt or InterPro

Protein Sequence (124 amino acids)

>Shew_1073 sigma 54 modulation protein/ribosomal protein S30EA (RefSeq) (Shewanella loihica PV-4)
MIKITSKDFEVTTPIRERIESRLEKLSRHDVQLINPHVIIGQEKQGFKIEASVGIPSNTL
FAQAKDKDLYAAINAMGQKLEKQLNRLSHKPEGARYTAPATSPTPESAELDDEYDETIDK
EYAA