Protein Info for Shew_1042 in Shewanella loihica PV-4

Annotation: Na+/H+ antiporter NhaA (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 391 transmembrane" amino acids 13 to 35 (23 residues), see Phobius details amino acids 59 to 77 (19 residues), see Phobius details amino acids 98 to 118 (21 residues), see Phobius details amino acids 124 to 144 (21 residues), see Phobius details amino acids 154 to 175 (22 residues), see Phobius details amino acids 181 to 197 (17 residues), see Phobius details amino acids 205 to 240 (36 residues), see Phobius details amino acids 255 to 277 (23 residues), see Phobius details amino acids 288 to 312 (25 residues), see Phobius details amino acids 328 to 351 (24 residues), see Phobius details amino acids 361 to 380 (20 residues), see Phobius details PF06965: Na_H_antiport_1" amino acids 7 to 380 (374 residues), 499.3 bits, see alignment E=3.1e-154 TIGR00773: Na+/H+ antiporter NhaA" amino acids 8 to 380 (373 residues), 560.7 bits, see alignment E=7.5e-173

Best Hits

Swiss-Prot: 100% identical to NHAA_SHELP: Na(+)/H(+) antiporter NhaA (nhaA) from Shewanella loihica (strain ATCC BAA-1088 / PV-4)

KEGG orthology group: K03313, Na+:H+ antiporter, NhaA family (inferred from 100% identity to slo:Shew_1042)

MetaCyc: 62% identical to Na+:H+ antiporter NhaA (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-129; TRANS-RXN-292

Predicted SEED Role

"Na+/H+ antiporter NhaA type" in subsystem Na(+) H(+) antiporter

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QBR5 at UniProt or InterPro

Protein Sequence (391 amino acids)

>Shew_1042 Na+/H+ antiporter NhaA (RefSeq) (Shewanella loihica PV-4)
MEKAIRNFLSQESAGGILLMAAVILAMIMANSPLSGLYQGFLHTEMQVRVGSLDIDKTLI
HWINDGLMALFFMLIGLEVKRELLEGALSSREQASLPTFAAIGGMIFPAAIYLIFNYADP
ITQVGWAIPAATDIAFALGIMALLGSRVPVALKVFLLALAIIDDLGVVVIIAMFYSTDLS
AISLVVAALAIVILVGLNRKGVTALAPYGVVGLILWIAVLKSGVHATLAGVIIAFCIPLR
AKDGSSPSEHLEHSLHPWSTFVILPIFAFANAGVDLSGMSLGDLLSPVPVGIALGLLLGK
PLGVLLFSFVAVKLKLAALPEGMGWRHIAPVAVMCGIGFTMSMFISSLAFIGDGEAYGDL
ARLGILTGSIMSAVIGYFWLSKVLPEKGEKS