Protein Info for Shew_1041 in Shewanella loihica PV-4

Name: thyA
Annotation: thymidylate synthase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 283 PF00303: Thymidylat_synt" amino acids 2 to 283 (282 residues), 263.9 bits, see alignment E=6.7e-83 TIGR03284: thymidylate synthase" amino acids 2 to 283 (282 residues), 148 bits, see alignment E=1.6e-47

Best Hits

Swiss-Prot: 100% identical to TYSY_SHELP: Thymidylate synthase (thyA) from Shewanella loihica (strain ATCC BAA-1088 / PV-4)

KEGG orthology group: K00560, thymidylate synthase [EC: 2.1.1.45] (inferred from 100% identity to slo:Shew_1041)

Predicted SEED Role

"Thymidylate synthase (EC 2.1.1.45)" in subsystem Folate Biosynthesis (EC 2.1.1.45)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.1.1.45

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QBR4 at UniProt or InterPro

Protein Sequence (283 amino acids)

>Shew_1041 thymidylate synthase (RefSeq) (Shewanella loihica PV-4)
MKQYLALCERIINEGVWVENERTGKRCLTVINADLEYDVAANEFPLITTRKSFWKGAIAE
LLGYLRGYDNAADFRKLGAKTWDANANENSAWLNNPHRKGHDDMGRVYGVQGRAWAKPDG
GVVDQLRKIIDNLSKGVDDRGEILSFYNPGEFHMGCLRPCMHTHNFSLLGDTLYLNSFQR
SCDVPLGLNFNQVQVFALLSIVAQITGHKPGKAYHKIVNAHIYEDQLPLMQEVQLKREPF
PSPKLSINPDIKSLEDLETWVTMDDFEVTGYQHHEAIQYPFSV