Protein Info for Shew_1040 in Shewanella loihica PV-4

Annotation: hypothetical protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 264 transmembrane" amino acids 12 to 38 (27 residues), see Phobius details amino acids 48 to 68 (21 residues), see Phobius details amino acids 78 to 100 (23 residues), see Phobius details amino acids 111 to 129 (19 residues), see Phobius details amino acids 141 to 168 (28 residues), see Phobius details amino acids 178 to 202 (25 residues), see Phobius details amino acids 213 to 234 (22 residues), see Phobius details amino acids 246 to 263 (18 residues), see Phobius details PF01925: TauE" amino acids 9 to 261 (253 residues), 166.2 bits, see alignment E=5.3e-53

Best Hits

KEGG orthology group: K07090, (no description) (inferred from 100% identity to slo:Shew_1040)

Predicted SEED Role

"Protein of unknown function DUF81" in subsystem ZZ gjo need homes

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QBR3 at UniProt or InterPro

Protein Sequence (264 amino acids)

>Shew_1040 hypothetical protein (RefSeq) (Shewanella loihica PV-4)
MFTIVVSCIALGAFIGFMAGLLGIGGGVIAVPVLLFLLPMAGVVPEHLTHVAIATSLAAI
ILTGASSARAHHARGNIPWHLLTIMLPGLIVGALSAGFISSLFSAQLLKQVFAGFLVLMA
LQMVFPFKAAEGERSLPASPYLFVTAMFVAIIAALMGIGGGILFIPFLTWCGVQMRHAIG
FSSVTGLMIALFGSLSYVFAGWATQGLPEYTLGYIYLPALFGIVCTSMLTAPLGAKAASV
WPTARLKKIFAVMLFFTGIKLALS