Protein Info for Shew_1014 in Shewanella loihica PV-4

Annotation: XRE family transcriptional regulator (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 168 transmembrane" amino acids 98 to 119 (22 residues), see Phobius details amino acids 125 to 153 (29 residues), see Phobius details PF01381: HTH_3" amino acids 3 to 55 (53 residues), 48.1 bits, see alignment E=1.9e-16 PF13560: HTH_31" amino acids 4 to 54 (51 residues), 32.4 bits, see alignment E=1.8e-11 PF13239: 2TM" amino acids 88 to 164 (77 residues), 81.3 bits, see alignment E=8.9e-27

Best Hits

KEGG orthology group: None (inferred from 100% identity to slo:Shew_1014)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QBN7 at UniProt or InterPro

Protein Sequence (168 amino acids)

>Shew_1014 XRE family transcriptional regulator (RefSeq) (Shewanella loihica PV-4)
MIIRKLRLQRAWSQEQLAQHSGLNVRTIQRLERGQKASLESLKSLASVFEVPLEALQQEM
DMSMTMDKQTDEAVNESLAPISSDERAAIEYVKELKGFYSNLVTMAIVLPLLYLLNLMIS
PGYMWVWWVVMGWGGGLVLHAISVFEPFSLFGASWEKRQIEKRLKRRL