Protein Info for Shew_0997 in Shewanella loihica PV-4

Annotation: DNA primase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 601 signal peptide" amino acids 1 to 29 (29 residues), see Phobius details TIGR01391: DNA primase" amino acids 29 to 438 (410 residues), 481.3 bits, see alignment E=1.2e-148 PF01807: Zn_ribbon_DnaG" amino acids 30 to 124 (95 residues), 133.9 bits, see alignment E=5.9e-43 PF08275: DNAG_N" amino acids 149 to 275 (127 residues), 149.3 bits, see alignment E=2.5e-47 PF13662: Toprim_4" amino acids 283 to 355 (73 residues), 57.7 bits, see alignment E=4.4e-19 PF01751: Toprim" amino acids 285 to 362 (78 residues), 57.5 bits, see alignment E=5.2e-19 PF13155: Toprim_2" amino acids 287 to 373 (87 residues), 65.6 bits, see alignment E=1.8e-21 PF10410: DnaB_bind" amino acids 394 to 442 (49 residues), 23.4 bits, see alignment 2.4e-08 PF08278: DnaG_DnaB_bind" amino acids 475 to 593 (119 residues), 91.1 bits, see alignment E=2.8e-29

Best Hits

KEGG orthology group: K02316, DNA primase [EC: 2.7.7.-] (inferred from 100% identity to slo:Shew_0997)

Predicted SEED Role

"DNA primase (EC 2.7.7.-)" in subsystem DNA-replication or Macromolecular synthesis operon (EC 2.7.7.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.7.-

Use Curated BLAST to search for 2.7.7.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QBM0 at UniProt or InterPro

Protein Sequence (601 amino acids)

>Shew_0997 DNA primase (RefSeq) (Shewanella loihica PV-4)
MSRAYARLVCFYSFGLISRKGGIYTAMAIPREFINELVARTDIVDLIDAKVPLKKAGKNH
SACCPFHSEKSPSFTVSRDKQFYHCFGCGAHGNAIDFVMEYDRLDFVDAIEELAGRLGLE
VPREQGTGKRRDEGLSRDLYQLMEEASRYFQSQLKQHTDKQKVLDYLAHRGLSDEVIEHF
NIGFAPDGWDGLLGRYRQNQDAQDKLLTAGMVIENDSGKRYDRFRDRLMFPIRDRRGRVI
GFGGRVLGDGTPKYLNSPETPIFHKGYELYGLYELKQRHRDPSQILIVEGYMDVVALTQF
GVDYAVASLGTSTTADQFQLLLRSAKEVICCYDGDKAGTEAAWRALETALPLLKPGDQVK
FMFLPQGEDPDSLVRQIGKPAFEQLIAEAKLLPEFLFDTLASRYGTDKGTLAKQAMSLIE
KVQDTVLQSLLLENLAYKLGMNSAEELQRKLGFKRIDANKPLQNKALKGRGTPLRLAIAL
LVQHPHLGNNLPVQPALKHIKMAGIDLLSLLLDRTRAEKVNSAQLLEQFRGDDQLDTLKK
LAQWEHQVADENLQQEFKKALIWLNNQYIEQRYQELSLKQHHTKEERMQLKKLIAVIQGQ
A