Protein Info for Shew_0977 in Shewanella loihica PV-4

Annotation: FAD dependent oxidoreductase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01946: Thi4
  • amino acids 17 to 77 (61 residues), 32 bits, E=2.3e-11
• PF01494: FAD_binding_3
  • amino acids 29 to 62 (34 residues), 24.3 bits, 5.5e-09
• PF01266: DAO
  • amino acids 31 to 382 (352 residues), 236.5 bits, E=2e-73
• PF13450: NAD_binding_8
  • amino acids 34 to 64 (31 residues), 22.4 bits, see alignment (E = 3.7e-08)

Best Hits

Swiss-Prot: 63% identical to PUUB_ECOLI: Gamma-glutamylputrescine oxidoreductase (puuB) from Escherichia coli (strain K12)

KEGG orthology group: K09471, gamma-glutamylputrescine oxidase [EC: 1.4.3.-] (inferred from 100% identity to slo:Shew_0977)

MetaCyc: 63% identical to gamma-glutamylputrescine oxidase (Escherichia coli K-12 substr. MG1655)
1.4.3.M3 [EC: 1.4.3.M3]

Predicted SEED Role

"Gamma-glutamyl-putrescine oxidase (EC1.4.3.-)"

MetaCyc Pathways

• superpathway of ornithine degradation (6/8 steps found)
• putrescine degradation II (3/4 steps found)
• superpathway of L-arginine and L-ornithine degradation (9/13 steps found)
• superpathway of L-arginine, putrescine, and 4-aminobutanoate degradation (7/11 steps found)

KEGG Metabolic Maps

• Arginine and proline metabolism
• Urea cycle and metabolism of amino groups

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.4.3.- or 1.4.3.M3

Sequence Analysis Tools

See A3QBK0 at UniProt or InterPro

Protein Sequence (428 amino acids)

>Shew_0977 FAD dependent oxidoreductase (RefSeq) (Shewanella loihica PV-4)
MTCTPHANSYYAASANTKALRDKLSDNIETDVCIIGAGYTGLSSAIHLLEAGFKVTVLEA
ARVGFGASGRNGGQIVNSFSRDIDTIEKVVGTEQAKLFGQMAFEGGRILKGLVAKYNIQC
DLKDGGVFAALNKKQMGHLEAQKALWEKHGHLGHLELLDEQGIRDVVDTERYVGGLLDKS
GGHIHPLNLALGEADAVESLGGQIFEDSAVVRVDQGENPVVHTQEGSVKCKFVIVAGNAY
LKGLLPELQAKSMPCGTQVITTEPLGEELAHSLLPQDYCVEDCNYLLDYFRLSGDKRLIY
GGGVVYGARDPANIEAIIRPKMLATFPQLKDVKIDFTWTGNFLLTLSRLPQVGRIGGNIY
YSQGCSGHGVTYTHLAGQILAETINGQAKRFDAFAQLPHYPFPGGHLLQVPFSAIGAWYY
TMRDKLGV