Protein Info for Shew_0967 in Shewanella loihica PV-4

Annotation: aldehyde dehydrogenase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 498 PF00171: Aldedh" amino acids 32 to 493 (462 residues), 554 bits, see alignment E=2.4e-170 PF05893: LuxC" amino acids 145 to 335 (191 residues), 23.5 bits, see alignment E=2.5e-09

Best Hits

Swiss-Prot: 57% identical to PUUC_ECOLI: NADP/NAD-dependent aldehyde dehydrogenase PuuC (puuC) from Escherichia coli (strain K12)

KEGG orthology group: K09472, gamma-glutamyl-gamma-aminobutyraldehyde dehydrogenase [EC: 1.2.1.-] (inferred from 100% identity to slo:Shew_0967)

MetaCyc: 73% identical to 4-guanidinobutyraldehyde dehydrogenase (Pseudomonas putida)
Gamma-guanidinobutyraldehyde dehydrogenase. [EC: 1.2.1.54]

Predicted SEED Role

"Gamma-glutamyl-aminobutyraldehyde dehydrogenase (EC 1.2.1.-)" (EC 1.2.1.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.2.1.-

Use Curated BLAST to search for 1.2.1.- or 1.2.1.54

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QBJ0 at UniProt or InterPro

Protein Sequence (498 amino acids)

>Shew_0967 aldehyde dehydrogenase (RefSeq) (Shewanella loihica PV-4)
MSTPQNREQWQEMADSLVIQGQAFINGEYCAADSNDTFDCISPIDGRVLTQVASCDLLDA
NRAVANAREVFERGDWSQLPPVKRKQVMIRFADLLEANRDELALLETLDMGKPIRYSGAV
DVAGAARALRWSGEAVDKIYDEIAPTAHNEIGMITREPVGVVAAIVPWNFPLLMACWKLG
PALATGNSVVLKPSEKSPLTAIRMAQLAIEAGIPKGVLNVLPGYGHTVGKALALHMDVDT
LVFTGSTKIAKQLMIYAGESNMKRVWLEAGGKSPNIVFNDAPNLKEAAIAAASAIAFNQG
EVCTAGSRLLVESGVKEELINLIEAEMQAWQPGHPLDPATTCGAVVDQQQLENVLRYIRA
GVAEGAQLRQGGQQVLAETGGVYVAPTIFANVKNEMTIAKEEIFGPVLSVITFDGMEEAI
RIGNDTIYGLAAGVWTSDISKAHKTAKALRSGMVWINHYDGGDMTAPFGGYKQSGNGRDK
SLHAFDKYTEIKATWIAL