Protein Info for Shew_0954 in Shewanella loihica PV-4

Annotation: ROK family protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 259 transmembrane" amino acids 185 to 194 (10 residues), see Phobius details PF00480: ROK" amino acids 5 to 227 (223 residues), 54.3 bits, see alignment E=7.6e-19

Best Hits

KEGG orthology group: None (inferred from 100% identity to slo:Shew_0954)

Predicted SEED Role

"ROK family protein, in a cluster with chitinase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QBH7 at UniProt or InterPro

Protein Sequence (259 amino acids)

>Shew_0954 ROK family protein (RefSeq) (Shewanella loihica PV-4)
MQSLTIDIGATTALFEIETQGRTEQYKIATGEHFTLADLNRHIVDIEADYGLSDYALGVA
VPGLVKQDTLIACKVAPKLNGLSLAKLKTQARFSLLHNDIDAGMLAVCDPKNACELLLMS
GAGIGMAIAIKGEPFLGAGGVAGELGHCRVMSEGGEYSLEQLASGESIRIRGLKSPQELY
RAGSYLGMGIAWAINLLNPNRIWLAGPMMNQPDYYKGCVESLRQLALTAPLGDVNIARVD
DMETLVCRGLKVLLAQHAE