Protein Info for Shew_0933 in Shewanella loihica PV-4

Annotation: methyltransferase type 11 (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 223 PF13489: Methyltransf_23" amino acids 33 to 192 (160 residues), 45.8 bits, see alignment E=2.1e-15 PF13847: Methyltransf_31" amino acids 44 to 151 (108 residues), 33.4 bits, see alignment E=1.2e-11 PF13649: Methyltransf_25" amino acids 46 to 140 (95 residues), 48.6 bits, see alignment E=3.8e-16 PF08241: Methyltransf_11" amino acids 47 to 144 (98 residues), 57.4 bits, see alignment E=6.8e-19 PF08242: Methyltransf_12" amino acids 47 to 142 (96 residues), 46.2 bits, see alignment E=2.2e-15 PF01209: Ubie_methyltran" amino acids 64 to 149 (86 residues), 39.3 bits, see alignment E=1.7e-13 PF20922: Anamorsin_N" amino acids 105 to 154 (50 residues), 30.1 bits, see alignment E=1.3e-10

Best Hits

KEGG orthology group: None (inferred from 100% identity to slo:Shew_0933)

Predicted SEED Role

"probable methyltransferase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QBF6 at UniProt or InterPro

Protein Sequence (223 amino acids)

>Shew_0933 methyltransferase type 11 (RefSeq) (Shewanella loihica PV-4)
MGAACEREADMSRIIAYCYDSFMRGPEQACLIDWRRNLLSQVSGRVLEIGAGTGASLPLY
PKGADLELVLTEPDIDMMRLLEKAVAELPDSHITLLDCPAESIDSEDSSFDWVFVSLVCC
TVHDLPGTLAEIWRVLKPGGRLLFLEHVAAEKGTRRRRWQDRLNFIWRRIAGNCHLNRET
EAQIRSAGFEIESITRESMRKAMPLARPTIRGVARKPLAPSEP