Protein Info for Shew_0924 in Shewanella loihica PV-4

Annotation: DNA polymerase III chi subunit, HolC (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF04364: DNA_pol3_chi
  • amino acids 1 to 147 (147 residues), 136.8 bits, E=2.9e-44

Best Hits

Swiss-Prot: 42% identical to HOLC_ECOLI: DNA polymerase III subunit chi (holC) from Escherichia coli (strain K12)

KEGG orthology group: K02339, DNA polymerase III subunit chi [EC: 2.7.7.7] (inferred from 100% identity to slo:Shew_0924)

MetaCyc: 42% identical to DNA polymerase III subunit chi (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"DNA polymerase III chi subunit (EC 2.7.7.7)" in subsystem DNA-replication (EC 2.7.7.7)

KEGG Metabolic Maps

• Purine metabolism
• Pyrimidine metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.7.7.7

Use Curated BLAST to search for 2.7.7.7

Sequence Analysis Tools

See A3QBE7 at UniProt or InterPro

Protein Sequence (153 amino acids)

>Shew_0924 DNA polymerase III chi subunit, HolC (RefSeq) (Shewanella loihica PV-4)
MPNALFYLMPQASSAATNVAKAEQESVYLFACRLAEQAYRGQQLVYIHCNDQQQAYEVDE
ILWQFEPSAFVPHNLKGEGPTGGAPVEIGFDKLGPNKNRHLLINLADQAPQFAVNFGQII
DFVANDAAMKATARDRYRQYRELGIPLTTQQPN