Protein Info for Shew_0916 in Shewanella loihica PV-4

Annotation: pseudouridine synthase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 236 PF01479: S4" amino acids 7 to 42 (36 residues), 24 bits, see alignment 2.7e-09 PF00849: PseudoU_synth_2" amino acids 66 to 194 (129 residues), 81.3 bits, see alignment E=9.1e-27 TIGR00093: pseudouridine synthase" amino acids 70 to 227 (158 residues), 144.7 bits, see alignment E=1e-46

Best Hits

Swiss-Prot: 50% identical to RSUA_PSEAE: Ribosomal small subunit pseudouridine synthase A (rsuA) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K06183, ribosomal small subunit pseudouridine synthase A [EC: 5.4.99.12] (inferred from 100% identity to slo:Shew_0916)

Predicted SEED Role

"Ribosomal small subunit pseudouridine synthase A (EC 4.2.1.70)" (EC 4.2.1.70)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.70, 5.4.99.12

Use Curated BLAST to search for 4.2.1.70 or 5.4.99.12

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QBD9 at UniProt or InterPro

Protein Sequence (236 amino acids)

>Shew_0916 pseudouridine synthase (RefSeq) (Shewanella loihica PV-4)
MSAKRARLDRFISQHCQIPRKQVRLILAKGRVSVDGQVVRDADCQIDQFSQVMLDGQALR
QEQPIYLMLHKPVGVVSATKDDEHKTVMDLLPDYQDKGLHIVGRLDLNTSGLLLLTNDSR
WSKRIMSPEHKVAKQYLVTLKAPLTQAYVKAFAEGFYFAFENITTQPAQLEILEPHLARV
TLHEGRYHQIKRMFGRFRNQVMALHRLSVGNLILDETLAVGQYRPLTPQEVASIFG