Protein Info for Shew_0861 in Shewanella loihica PV-4

Annotation: extracellular solute-binding protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 335 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details PF13531: SBP_bac_11" amino acids 26 to 282 (257 residues), 61.1 bits, see alignment E=2.8e-20 PF01547: SBP_bac_1" amino acids 34 to 280 (247 residues), 57.7 bits, see alignment E=4e-19 PF13416: SBP_bac_8" amino acids 40 to 307 (268 residues), 42.8 bits, see alignment E=1.2e-14 PF13343: SBP_bac_6" amino acids 73 to 296 (224 residues), 61.7 bits, see alignment E=1.5e-20

Best Hits

Swiss-Prot: 45% identical to FUTA1_SYNY3: Iron uptake protein A1 (futA1) from Synechocystis sp. (strain PCC 6803 / Kazusa)

KEGG orthology group: K02012, iron(III) transport system substrate-binding protein (inferred from 100% identity to slo:Shew_0861)

Predicted SEED Role

"Ferric iron ABC transporter, iron-binding protein" in subsystem Campylobacter Iron Metabolism or Iron acquisition in Vibrio or Transport of Iron

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QB85 at UniProt or InterPro

Protein Sequence (335 amino acids)

>Shew_0861 extracellular solute-binding protein (RefSeq) (Shewanella loihica PV-4)
MRFMKRLAVLGFACVTSMANAADSITVYSYRQAFLIDPILADFTKETGIKVNLVFTKQGI
AERIAREGRLSPADLVLTSDFSRLMELADKGLVASVDSQTLAQNIPANLRSPNGDWFALT
KRVRNIYSSKERLGPLDIDYEDLADPKFKGKICTRSGKHPYNISLVASMIAHHGEADTKT
WLEGVKANLARKPQGNDRAQVKAVKEGLCDIAIGNSYYLGKMLQDPKQVPWAEAVNINFP
NQKNRGAHINVSGMALAKYAPERENAIKLMEYLSGQQAQQTYAELNMEYPVKADVKPSKL
VASWGDYKADELPIHKLAEYHGAAVKLLDQVKFDL