Protein Info for Shew_0853 in Shewanella loihica PV-4

Annotation: ABC transporter-related protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 591 transmembrane" amino acids 33 to 54 (22 residues), see Phobius details amino acids 69 to 87 (19 residues), see Phobius details amino acids 147 to 170 (24 residues), see Phobius details amino acids 175 to 195 (21 residues), see Phobius details amino acids 257 to 281 (25 residues), see Phobius details amino acids 294 to 315 (22 residues), see Phobius details PF00664: ABC_membrane" amino acids 33 to 308 (276 residues), 161 bits, see alignment E=5.2e-51 PF00005: ABC_tran" amino acids 369 to 518 (150 residues), 117.1 bits, see alignment E=9.7e-38

Best Hits

Swiss-Prot: 47% identical to ABCB5_DICDI: ABC transporter B family member 5 (abcB5) from Dictyostelium discoideum

KEGG orthology group: K06147, ATP-binding cassette, subfamily B, bacterial (inferred from 100% identity to slo:Shew_0853)

Predicted SEED Role

"Lipid A export ATP-binding/permease protein MsbA" in subsystem ZZ gjo need homes

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QB77 at UniProt or InterPro

Protein Sequence (591 amino acids)

>Shew_0853 ABC transporter-related protein (RefSeq) (Shewanella loihica PV-4)
MRPTLYFDGPIDKLNWHVLKLLWPYLLEFKGRVILALACLVVAKMASVGLPFVLKQLVDT
LSEASVEQMIAVPIALVLAYGSLRLLNTVISEVRDTLFGRVTERAIRRLGLSVFDHLHRL
DLAFHLERRTGGLSRDIERGTSGVSFLMRFMVFNIVPTLLEIGLVVGILLYNYGWAFALI
TLSAVVAYILFSIFATEWRTGFVREAAMADSQSNTRAIDSLLNYETVKYFNNEAYESEQY
DHALERWEVAKRKNRLSLFALNAGQALIISLAMTLMLALAATQVSQGAMTIGDFVLINAF
MMQLFMPLNFLGFVYREIRGALANIERMFSLLDRQPKIEDGPDATSPQIAQGSLKFEGVS
FRYGDRPILSDVSFEIPAGHKVAIVGDSGAGKSTIVKLLFRFYETQQGTITIDGHDTKAL
TQHALRSAIAIVPQDTVLFNDSLMENIRYGLPGASDEQVKAAIELAHLSNFVSQLSEGWH
TKVGERGLKLSGGEKQRVAIARAILKGSPLLVFDEATSSLDSHSEQAILNALKEMAKGHT
SLVIAHRLSTVVDADQILVLSQGKIVERGDHQSLLAADGLYKKLWTVQNQH