Protein Info for Shew_0844 in Shewanella loihica PV-4

Name: nrfA
Annotation: cytochrome c nitrite reductase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 466 signal peptide" amino acids 1 to 28 (28 residues), see Phobius details TIGR03152: formate-dependent cytochrome c nitrite reductase, c552 subunit" amino acids 32 to 464 (433 residues), 731.6 bits, see alignment E=1.5e-224 PF02335: Cytochrom_C552" amino acids 36 to 461 (426 residues), 616.1 bits, see alignment E=3.9e-189

Best Hits

Swiss-Prot: 90% identical to NRFA_SHESH: Cytochrome c-552 (nrfA) from Shewanella sediminis (strain HAW-EB3)

KEGG orthology group: K03385, formate-dependent nitrite reductase, periplasmic cytochrome c552 subunit [EC: 1.7.2.2] (inferred from 100% identity to slo:Shew_0844)

MetaCyc: 63% identical to dissimilatory nitrite reductase (ammonia-forming) monomer (Aliivibrio fischeri)
Nitrite reductase (cytochrome; ammonia-forming). [EC: 1.7.2.2]

Predicted SEED Role

"Cytochrome c552 precursor (EC 1.7.2.2)" in subsystem Nitrate and nitrite ammonification or Soluble cytochromes and functionally related electron carriers (EC 1.7.2.2)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.7.2.2

Use Curated BLAST to search for 1.7.2.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QB68 at UniProt or InterPro

Protein Sequence (466 amino acids)

>Shew_0844 cytochrome c nitrite reductase (RefSeq) (Shewanella loihica PV-4)
MVRTLTTKTFALSALVAAGLMATGVMASDKTEPRNEVYKDKFSKQYNSWHDTAESKEVVD
MLEEVPSLVVLWAGYGFAKDYNAPRGHMYAVTDVRNTLRTGAPKSAEDGPMPMACWSCKS
PDVPRVIEEQGEDGYFTGKWYKGGAEIVNTIGCSDCHEKGSSKLRMSRPFAERAMATLGT
PFDKASKKDKQSMVCGQCHVEYYFEKTKDRKGFVKFPWDMGTTVEQMEVYYDNMEFKDWT
HAVSKTPMLKAQHPGYETWQLGVHGKNNVTCTDCHMPKVKNAEGRKFTDHKVGNPFDRFE
ETCATCHTQSKEFMVNLTKERKVKVADLKARAESQLVKAHFEAKAAWDAGATEAEMKPIL
MDIRHAQWRWDYATASHGVAAHAADEALRILGTAVDKAGDARIKLAQLLATKGVKQPIAF
PDVSTKAKAQAALGMDMNKLNADKAEFKKTVLPKWDAEAKKREATY