Protein Info for Shew_0843 in Shewanella loihica PV-4

Annotation: nitrate/nitrite sensor protein NarQ (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 567 signal peptide" amino acids 1 to 36 (36 residues), see Phobius details transmembrane" amino acids 148 to 168 (21 residues), see Phobius details PF13675: PilJ" amino acids 32 to 127 (96 residues), 75.7 bits, see alignment E=6.4e-25 PF00672: HAMP" amino acids 172 to 220 (49 residues), 21.4 bits, see alignment 5.2e-08 PF07730: HisKA_3" amino acids 364 to 429 (66 residues), 56.7 bits, see alignment E=5.8e-19 PF02518: HATPase_c" amino acids 473 to 562 (90 residues), 44.3 bits, see alignment E=4.3e-15

Best Hits

KEGG orthology group: K07674, two-component system, NarL family, nitrate/nitrite sensor histidine kinase NarQ [EC: 2.7.13.3] (inferred from 100% identity to slo:Shew_0843)

Predicted SEED Role

"Nitrate/nitrite sensor protein (EC 2.7.3.-)" in subsystem Nitrate and nitrite ammonification (EC 2.7.3.-)

Isozymes

Compare fitness of predicted isozymes for: 2.7.13.3, 2.7.3.-

Use Curated BLAST to search for 2.7.13.3 or 2.7.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QB67 at UniProt or InterPro

Protein Sequence (567 amino acids)

>Shew_0843 nitrate/nitrite sensor protein NarQ (RefSeq) (Shewanella loihica PV-4)
MKKGSLTSTILRLMLALILLSSGLATFAIANLAYSLGDARAINASGSLRMQSYRLMFYAN
SGSEGADDKIREFEATLHSDALKRSLDWMTPDDLASQYLLVIQKWQVMKQYIEEENSRLY
VSALKDFVDTIDLFVLETEEFAAFKLKLLAASQITGLGLMLLIAFFAVRFTKRKVVTPLN
QLMESANTISKGEFDVTMPDSEYIELSSLSNALATSAKELSTLYNNLENQVKEKTFALTR
ANNELKLLYDNLVMLHSGKLEISTLKQALNQLRAHEPNSFLRLVIAQDDKEKLYIDADGG
WPIASRSQTRFPLKFADNELGYLEVTALGEINHPLFENFAIMLARSIVIYNAGEQRQQLA
LMEERGVIARELHDSLGQLLSFLKIQVNLLSKGLDSQCRSPQVEEQLKEINEGVNTAYVQ
LRELLSTFRLTIKDPNLNHAIEMMLDQLRGQTTAKITLEDKLPIQLLGAHQHIHVLQLTR
EATLNAIKHAQADHIHICCTRSGNNVKISISDDGVGLEKLKERDQHFGIGIMHERASRLS
GVVDFSSNEQGGTTVTLLFPPEQEPRQ