Protein Info for Shew_0826 in Shewanella loihica PV-4

Annotation: hypothetical protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 307 transmembrane" amino acids 71 to 100 (30 residues), see Phobius details amino acids 145 to 160 (16 residues), see Phobius details amino acids 169 to 191 (23 residues), see Phobius details amino acids 226 to 249 (24 residues), see Phobius details amino acids 261 to 279 (19 residues), see Phobius details amino acids 285 to 303 (19 residues), see Phobius details PF05661: DUF808" amino acids 4 to 297 (294 residues), 395 bits, see alignment E=1e-122

Best Hits

Swiss-Prot: 62% identical to YEDI_ECOLI: Inner membrane protein YedI (yedI) from Escherichia coli (strain K12)

KEGG orthology group: K09781, hypothetical protein (inferred from 100% identity to slo:Shew_0826)

Predicted SEED Role

"Membrane protein, putative"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QB50 at UniProt or InterPro

Protein Sequence (307 amino acids)

>Shew_0826 hypothetical protein (RefSeq) (Shewanella loihica PV-4)
MAGASLLTLLDDIAAILDDVALMSKVAARKTAGVLGDDLALNAQQVSGVNADRELPVVWA
VAKGSLRNKCILVPAALLISAFIPWAVTPLLMFGGLFLCYEGFEKVYHSLTHKHEPAMSQ
SEMAKAAEDLKAFEKQKVAGAIRTDFVLSAEIIAITLGVVAESSFMTQVVTLAIIAVLMT
VGVYGLVAGIVKLDDAGLYLSQRQGDGLLRRLGRKLGGGLVNAAPYLMRGLTVVGTIAMF
MVGGGILTHGIHQIAEVFEQAAHWVAGLTIVGPVLAWMTPSLLNALFGVLVGAVALVVMS
LIGRLRN