Protein Info for Shew_0815 in Shewanella loihica PV-4

Updated annotation (from data): Glucosamine-6-phosphate deaminase (EC 3.5.99.6)
Rationale: Specifically important for utilizing N-Acetyl-D-Glucosamine. Automated validation from mutant phenotype: the predicted function (GLUCOSAMINE-6-P-DEAMIN-RXN) was linked to the condition via a MetaCyc pathway. This annotation was also checked manually.
Original annotation: glucosamine-6-phosphate isomerase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00502: glucosamine-6-phosphate deaminase
  • amino acids 1 to 246 (246 residues), 307 bits, E=5.1e-96
• PF01182: Glucosamine_iso
  • amino acids 10 to 228 (219 residues), 85.8 bits, E=2e-28

Best Hits

Swiss-Prot: 100% identical to NAGB_SHELP: Glucosamine-6-phosphate deaminase (nagB) from Shewanella loihica (strain ATCC BAA-1088 / PV-4)

KEGG orthology group: K02564, glucosamine-6-phosphate deaminase [EC: 3.5.99.6] (inferred from 100% identity to slo:Shew_0815)

MetaCyc: 43% identical to glucosamine-6-phosphate deaminase (Escherichia coli K-12 substr. MG1655)
Glucosamine-6-phosphate deaminase. [EC: 3.5.99.6]

Predicted SEED Role

"Glucosamine-6-phosphate deaminase (EC 3.5.99.6)" in subsystem Chitin and N-acetylglucosamine utilization or Sialic Acid Metabolism or UDP-N-acetylmuramate from Fructose-6-phosphate Biosynthesis (EC 3.5.99.6)

MetaCyc Pathways

• N-acetylglucosamine degradation II (3/3 steps found)
• N-acetylglucosamine degradation I (2/2 steps found)
• superpathway of N-acetylneuraminate degradation (16/22 steps found)
• UDP-N-acetyl-D-galactosamine biosynthesis II (5/7 steps found)
• superpathway of N-acetylglucosamine, N-acetylmannosamine and N-acetylneuraminate degradation (2/6 steps found)
• chitin derivatives degradation (3/8 steps found)
• chitin degradation I (archaea) (2/7 steps found)

KEGG Metabolic Maps

• Aminosugars metabolism
• Nucleotide sugars metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.99.6

Sequence Analysis Tools

See A3QB39 at UniProt or InterPro

Protein Sequence (268 amino acids)

>Shew_0815 Glucosamine-6-phosphate deaminase (EC 3.5.99.6) (Shewanella loihica PV-4)
MQIVILKDSAEVAEYGANLIINQLKRKPDSVLGLATGSTPVSLYQRLVAANQAGAVSFEG
VTSFNLDEYLGLEGSHPQSYRYFMDSQLFDAIDINKANTHVPPGDAEDPIAACEAYEAQI
QAAGGIDIQLLGIGRNGHIGFNEPSSGLMSRTRVKTLTQATIEDNARFFAEGEYQPHLSI
TMGIGTILDAKKVLLLATGESKADAIRAAVEGALSAACPASALQLHRDAVLVIDEAAASK
LADKEFYRHIEAENQLLQARLAALKAGE