Protein Info for Shew_0810 in Shewanella loihica PV-4

Annotation: ion transport 2 domain-containing protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 326 transmembrane" amino acids 231 to 249 (19 residues), see Phobius details amino acids 270 to 289 (20 residues), see Phobius details amino acids 300 to 321 (22 residues), see Phobius details PF00805: Pentapeptide" amino acids 89 to 126 (38 residues), 29.8 bits, see alignment 3.4e-11 PF07885: Ion_trans_2" amino acids 271 to 325 (55 residues), 37.6 bits, see alignment E=1.7e-13

Best Hits

KEGG orthology group: None (inferred from 100% identity to slo:Shew_0810)

Predicted SEED Role

"Kef-type K+ transport system, predicted NAD-binding component"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QB34 at UniProt or InterPro

Protein Sequence (326 amino acids)

>Shew_0810 ion transport 2 domain-containing protein (RefSeq) (Shewanella loihica PV-4)
MKQTNQCCYHEDEGFSCTEPAEASGLCYWHDPKIIKDKPEDIARLEAFARNGGMLRGISL
KRANLPGIDLVRHHQKTGFDMSHAELYRANLQGAHMFNLNLQHASLMKADLREANVHCAN
LVGTNLLGIKWNGAKIENINTGKLLRQERLANEAERVGENEIALDYFEQAEEIYRDLRKA
AEREGLFAMGGDYLRKELTMRRHQMPKYSYSRILSKMIDIFCGYGEAPTRVIGFSMGLIF
VCALLYLFTGLNYDGNIHVFNWQNDLTTNLALFFNCIYYSVVTFTTLGYGDFTPIGYSRA
IAAVEAFTGSFTIALFVVVFVKKMTR