Protein Info for Shew_0802 in Shewanella loihica PV-4

Annotation: chromate transporter (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 402 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details transmembrane" amino acids 22 to 22 (1 residues), see Phobius details amino acids 44 to 63 (20 residues), see Phobius details amino acids 74 to 97 (24 residues), see Phobius details amino acids 105 to 127 (23 residues), see Phobius details amino acids 136 to 154 (19 residues), see Phobius details amino acids 160 to 180 (21 residues), see Phobius details amino acids 204 to 222 (19 residues), see Phobius details amino acids 234 to 254 (21 residues), see Phobius details amino acids 266 to 287 (22 residues), see Phobius details amino acids 297 to 318 (22 residues), see Phobius details amino acids 330 to 373 (44 residues), see Phobius details amino acids 381 to 401 (21 residues), see Phobius details PF02417: Chromate_transp" amino acids 3 to 168 (166 residues), 131.4 bits, see alignment E=1.6e-42 amino acids 229 to 392 (164 residues), 108.7 bits, see alignment E=1.5e-35 TIGR00937: chromate efflux transporter" amino acids 8 to 391 (384 residues), 260.4 bits, see alignment E=2e-81

Best Hits

KEGG orthology group: K07240, chromate transporter (inferred from 100% identity to slo:Shew_0802)

Predicted SEED Role

"Chromate transport protein ChrA"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QB26 at UniProt or InterPro

Protein Sequence (402 amino acids)

>Shew_0802 chromate transporter (RefSeq) (Shewanella loihica PV-4)
MGEVFKQFLLLGLMSFGGPAAHIGYFKRRFVDDLGWLDAERFGAIVAMSQVIPGPGSSQV
GFAIGHHKAGLPGALAAFLGFTLPSFLLLYLMAVASLSWLDTSWFQGLIHGLKLMAVVVV
ADAVLSMFKQFCRRGATRILMLLCASLTLFVGTLASQLGLLILAAVIGAVCLAPSALRGI
DQDAGRQGAKGGEGGAVDTLRPQMLPLMLFILLFGLSLFWLGTGHSLSQLFAQFYQAGAL
VFGGGHVVLPLLEASVGQQLTSERFLTGYALAQAVPGPMFTLAAFLGAESWLESPLLGAL
VATLAIFLPGFLLQLSLLRSWHGLMGRARFRGAIMGINAAVVGLLLAALISPVIASAILA
WPDALLVLIGLAWQLRYRPSILMLLLGFALTGILLGVLGGLS