Protein Info for Shew_0800 in Shewanella loihica PV-4

Annotation: FAD dependent oxidoreductase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 413 PF01266: DAO" amino acids 5 to 355 (351 residues), 177.9 bits, see alignment E=4.3e-56

Best Hits

KEGG orthology group: K00111, glycerol-3-phosphate dehydrogenase [EC: 1.1.5.3] (inferred from 100% identity to slo:Shew_0800)

Predicted SEED Role

"Aerobic glycerol-3-phosphate dehydrogenase (EC 1.1.5.3)" in subsystem Glycerol and Glycerol-3-phosphate Uptake and Utilization or Glycerolipid and Glycerophospholipid Metabolism in Bacteria or Respiratory dehydrogenases 1 (EC 1.1.5.3)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.5.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QB24 at UniProt or InterPro

Protein Sequence (413 amino acids)

>Shew_0800 FAD dependent oxidoreductase (RefSeq) (Shewanella loihica PV-4)
MQAVDLVVIGGGITGVGIAQCVQAAGYSVVLLEKDNLGEKTSSNSSKLIHGGLRYLESGQ
LGLVRQSLSERKALLTLAPELVKPVPFYIPIYRGSQRGPLAIRAGLSLYALLSELDPLGQ
FQSVPASRWSELAGLKLKGLRAVFRYWDAQTDDGALTRAVAQSARALGAELLTQVSLEQI
EHRPDSCIVSFSHKGETRRLSSRCVINATGPWVNQTLERVTPKVEVSPVELVQGSHLVLD
IPAPSGIFYLESIFDKRVVFVMPWQGKTMIGTTETPIDAVDAAGVTPAEEAYLLGIYRHY
FPLSENDGALEERITGRYCGVRVLPKQGGEAFDLPRDTMMLSRDTHPNLLTVYGGKLTTF
RHTAKEALAWVKNRRGPKPIRADVDKLRLTPVTDEAPSSESPTAKGDFSPQKG