Protein Info for Shew_0799 in Shewanella loihica PV-4

Annotation: MarR family transcriptional regulator (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 161 PF22381: Staph_reg_Sar_Rot" amino acids 41 to 121 (81 residues), 58.8 bits, see alignment E=1.4e-19 PF12802: MarR_2" amino acids 49 to 106 (58 residues), 42.2 bits, see alignment E=2.3e-14 PF01047: MarR" amino acids 50 to 107 (58 residues), 55.4 bits, see alignment E=1.4e-18 PF13412: HTH_24" amino acids 60 to 97 (38 residues), 23.8 bits, see alignment 7.8e-09 PF03551: PadR" amino acids 74 to 119 (46 residues), 27.1 bits, see alignment E=1e-09

Best Hits

KEGG orthology group: None (inferred from 100% identity to slo:Shew_0799)

Predicted SEED Role

"Organic hydroperoxide resistance transcriptional regulator" in subsystem Oxidative stress

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QB23 at UniProt or InterPro

Protein Sequence (161 amino acids)

>Shew_0799 MarR family transcriptional regulator (RefSeq) (Shewanella loihica PV-4)
MMAIQFMSQSTSQDIQPNPLALENQVCFSLYSAANAMVRAYRPLLEALDLTYSQYLAMLV
LWQEPGISVKTLGEQLHLDSGTLTPLLKRLESKGLVTRGRSEADERVRVLQLTDAGRELQ
QQARSIPMQMRCKLGGEPEEFAELKRLCDKAYRYLDAASQG