Protein Info for Shew_0794 in Shewanella loihica PV-4

Annotation: diguanylate cyclase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 394 transmembrane" amino acids 26 to 44 (19 residues), see Phobius details amino acids 56 to 75 (20 residues), see Phobius details amino acids 86 to 107 (22 residues), see Phobius details amino acids 119 to 138 (20 residues), see Phobius details amino acids 144 to 162 (19 residues), see Phobius details amino acids 168 to 190 (23 residues), see Phobius details PF17178: MASE5" amino acids 22 to 213 (192 residues), 142.1 bits, see alignment E=1.7e-45 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 211 to 374 (164 residues), 152.6 bits, see alignment E=4.1e-49 PF00990: GGDEF" amino acids 214 to 373 (160 residues), 159.1 bits, see alignment E=8.3e-51

Best Hits

KEGG orthology group: None (inferred from 100% identity to slo:Shew_0794)

Predicted SEED Role

"Two-component response regulator"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QB18 at UniProt or InterPro

Protein Sequence (394 amino acids)

>Shew_0794 diguanylate cyclase (RefSeq) (Shewanella loihica PV-4)
MNSKPKSFDELLIQETHIYLCRSVKWTAYLSVFLLVAIFLASMLQKNSLLTLQDLLVLQM
PTLCIALFGLAGILYRQPEQHRMGLVLAYLLVLEVAWIYFVVGHYWLTSSYNLLGEYGSL
ATVDSVTDVLVFTFAISLYPVRRWLLVSVVPLLLVSLVTRLIEIPENPIFALTKFVCLLV
IIITGQKVLLQWFRKAILRDAEKQQLLQQFKRMALIDGLTDLSNRRHFDEVLALEIKAAE
RTGDPLSMILLDVDFFKRLNDSLGHSDGDRCLVRLGEVLHGVASRPRDLAARYGGEEFAI
ILPDTDLSGARHIAEQIRYELKAAEIPHPDSTLGAYVTVSQGVCLWQPGLDADELLASAD
QLLYQSKAQGRDRCSTGVAKGEAAEDKVVSSYLS