Protein Info for Shew_0792 in Shewanella loihica PV-4

Annotation: alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 189 TIGR03137: peroxiredoxin" amino acids 4 to 189 (186 residues), 344.5 bits, see alignment E=7.4e-108 PF00578: AhpC-TSA" amino acids 8 to 135 (128 residues), 125.8 bits, see alignment E=1.9e-40 PF08534: Redoxin" amino acids 21 to 140 (120 residues), 48.2 bits, see alignment E=2.1e-16 PF02630: SCO1-SenC" amino acids 25 to 74 (50 residues), 25.1 bits, see alignment E=3.1e-09 PF10417: 1-cysPrx_C" amino acids 156 to 184 (29 residues), 31.3 bits, see alignment 3.2e-11

Best Hits

Swiss-Prot: 70% identical to AHPC_SALTY: Alkyl hydroperoxide reductase C (ahpC) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K03386, peroxiredoxin (alkyl hydroperoxide reductase subunit C) [EC: 1.11.1.15] (inferred from 100% identity to slo:Shew_0792)

MetaCyc: 69% identical to alkyl hydroperoxide reductase, AhpC component (Escherichia coli K-12 substr. MG1655)
R4-RXN [EC: 1.11.1.26]

Predicted SEED Role

"Alkyl hydroperoxide reductase protein C (EC 1.6.4.-)" in subsystem Thioredoxin-disulfide reductase (EC 1.6.4.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.11.1.15, 1.6.4.-

Use Curated BLAST to search for 1.11.1.15 or 1.11.1.26 or 1.6.4.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QB16 at UniProt or InterPro

Protein Sequence (189 amino acids)

>Shew_0792 alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen (RefSeq) (Shewanella loihica PV-4)
MTQSIINTEIKPFSATAYHKGDFVSVTEQDLLGKWSVVFFYPADFTFVCPTELGDMADHY
EKLQSMGVEVYSVSTDTHFTHKAWHDSSDTIGKINYPMIGDPTGVISRNFGVMIEEEGLA
LRGTFVINPEGQIKVAEIHDLGIGRSASELVRKIQAAQYVATHDGEVCPAAWQPGEETLA
PSLDLVGKI