Protein Info for Shew_0769 in Shewanella loihica PV-4

Annotation: branched-chain amino acid transport system II carrier protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 443 transmembrane" amino acids 12 to 31 (20 residues), see Phobius details amino acids 43 to 65 (23 residues), see Phobius details amino acids 74 to 96 (23 residues), see Phobius details amino acids 131 to 148 (18 residues), see Phobius details amino acids 159 to 180 (22 residues), see Phobius details amino acids 202 to 222 (21 residues), see Phobius details amino acids 237 to 259 (23 residues), see Phobius details amino acids 290 to 312 (23 residues), see Phobius details amino acids 324 to 343 (20 residues), see Phobius details amino acids 349 to 371 (23 residues), see Phobius details amino acids 383 to 402 (20 residues), see Phobius details amino acids 414 to 433 (20 residues), see Phobius details PF05525: Branch_AA_trans" amino acids 8 to 435 (428 residues), 459.8 bits, see alignment E=5.1e-142 TIGR00796: branched-chain amino acid transport system II carrier protein" amino acids 15 to 422 (408 residues), 414.6 bits, see alignment E=2.3e-128

Best Hits

Swiss-Prot: 49% identical to BRAB_PSEAE: Branched-chain amino acid transport system 2 carrier protein (braB) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K03311, branched-chain amino acid:cation transporter, LIVCS family (inferred from 100% identity to slo:Shew_0769)

MetaCyc: 43% identical to branched chain amino acid transporter BrnQ (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-126; TRANS-RXN-126A; TRANS-RXN-126B

Predicted SEED Role

"Branched-chain amino acid transport system carrier protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QAZ3 at UniProt or InterPro

Protein Sequence (443 amino acids)

>Shew_0769 branched-chain amino acid transport system II carrier protein (RefSeq) (Shewanella loihica PV-4)
MQNNKLSMTDTLGLGFMTFAFFLGAGNLIFPPLAGFLAGENMSWAMIGFLLTAVTLPLVT
LIAVAKANGKVMGLLPPLAATMLAIAIYIIIGPAFAAPRAGLVAYEMGYKPFIQDAQASF
EVAGVVFTSSQLLYTSIFFGIAMLLSLFPGKLLDSVGKVLTPIMIILLVGLAISVVVLPG
SDVAAAVGDYQTNPLTKGIIEGYNTMDTLASLIFGMLIIDLLRKKGVDSPREQTKYLVRA
AFIAAGGLAFVYVSLFYLGATAGDLAVGADNGGVILTNYVNYQFGASGQLLLAAVVTLAC
LTTVVGLVSACAEYFNELMPSLSYKLLVVVMSVTCAVVANVGLAQLINISIPVLVTIYPV
AIALVAVTYLTERFAQPAFAHRMVLSVALVFGIIDGLKAAGVNMSMFDVMPLSAQGMAWL
IPTAITIFACLMVKRPRGEAVLN