Protein Info for Shew_0755 in Shewanella loihica PV-4

Annotation: fructose-1,6-bisphosphate aldolase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00167: ketose-bisphosphate aldolase
  • amino acids 1 to 327 (327 residues), 311.7 bits, E=4.9e-97
• TIGR01521: fructose-bisphosphate aldolase, class II, Calvin cycle subtype
  • amino acids 3 to 349 (347 residues), 633.1 bits, E=1.2e-194
• PF01116: F_bP_aldolase
  • amino acids 5 to 327 (323 residues), 310.8 bits, E=4.9e-97

Best Hits

Swiss-Prot: 78% identical to ALF_PSEST: Fructose-bisphosphate aldolase (fba) from Pseudomonas stutzeri

KEGG orthology group: K01624, fructose-bisphosphate aldolase, class II [EC: 4.1.2.13] (inferred from 100% identity to slo:Shew_0755)

MetaCyc: 64% identical to class II fructose-bisphosphate aldolase/sedoheptulose-1,7-bisphosphate aldolase monomer (Synechocystis sp. PCC 6803)
Fructose-bisphosphate aldolase. [EC: 4.1.2.13]; 4.1.2.13 [EC: 4.1.2.13]

Predicted SEED Role

"Fructose-bisphosphate aldolase class II (EC 4.1.2.13)" in subsystem Calvin-Benson cycle or Glycolysis and Gluconeogenesis (EC 4.1.2.13)

MetaCyc Pathways

• gluconeogenesis I (13/13 steps found)
• superpathway of glycolysis, pyruvate dehydrogenase, TCA, and glyoxylate bypass (22/26 steps found)
• superpathway of glycolysis and the Entner-Doudoroff pathway (15/17 steps found)
• superpathway of cytosolic glycolysis (plants), pyruvate dehydrogenase and TCA cycle (18/22 steps found)
• Calvin-Benson-Bassham cycle (11/13 steps found)
• glycolysis I (from glucose 6-phosphate) (11/13 steps found)
• 1-butanol autotrophic biosynthesis (engineered) (21/27 steps found)
• formaldehyde assimilation III (dihydroxyacetone cycle) (10/12 steps found)
• superpathway of anaerobic sucrose degradation (15/19 steps found)
• photosynthetic 3-hydroxybutanoate biosynthesis (engineered) (20/26 steps found)
• glycolysis II (from fructose 6-phosphate) (9/11 steps found)
• glycolysis III (from glucose) (9/11 steps found)
• ethene biosynthesis V (engineered) (19/25 steps found)
• pentose phosphate pathway (non-oxidative branch) II (5/6 steps found)
• sucrose biosynthesis I (from photosynthesis) (7/9 steps found)
• homolactic fermentation (9/12 steps found)
• hexitol fermentation to lactate, formate, ethanol and acetate (14/19 steps found)
• superpathway of N-acetylneuraminate degradation (16/22 steps found)
• glycolysis IV (7/10 steps found)
• glycolysis V (Pyrococcus) (7/10 steps found)
• oxygenic photosynthesis (12/17 steps found)
• sedoheptulose bisphosphate bypass (1/2 steps found)
• formaldehyde assimilation II (assimilatory RuMP Cycle) (6/9 steps found)
• gluconeogenesis III (8/12 steps found)
• glycolysis VI (from fructose) (7/11 steps found)
• sucrose degradation V (sucrose α-glucosidase) (2/5 steps found)
• 1,3-propanediol biosynthesis (engineered) (4/9 steps found)
• superpathway of hexitol degradation (bacteria) (10/18 steps found)
• gluconeogenesis II (Methanobacterium thermoautotrophicum) (8/18 steps found)
• Methanobacterium thermoautotrophicum biosynthetic metabolism (21/56 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of alkaloids derived from terpenoid and polyketide
• Biosynthesis of phenylpropanoids
• Biosynthesis of plant hormones
• Biosynthesis of terpenoids and steroids
• Carbon fixation in photosynthetic organisms
• Fructose and mannose metabolism
• Glycolysis / Gluconeogenesis
• Pentose phosphate pathway

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.2.13

Sequence Analysis Tools

See A3QAX9 at UniProt or InterPro

Protein Sequence (354 amino acids)

>Shew_0755 fructose-1,6-bisphosphate aldolase (RefSeq) (Shewanella loihica PV-4)
MALISLRQLLDHAAEHGYGVPAFNVNNLEQMRAIMQAAEATDSPVIVQASAGARKYARPQ
FLKYLMAAALEQYPDIPVCIHQDHGTHPDVCQRSIQLGMSSVMMDGSLMSDGKTPASYEY
NVDVTRKTVAFAHACGVSVEGEIGCLGSLETGQAGEEDGVGAEGILSEDQLLTTPEEAAR
FVADTHVDALAIAIGTSHGAYKFSRKPTGDVLRIDRIKEIHARIPNTHLVMHGSSSVPQE
WLEVINQYGGAIPETYGVPLEEIVEGIKHGVRKVNIDTDLRLASTGAVRKFLAENPSEFD
PRKFLKASMDAMADICTVRYEAFGAAGMGSKIKPKSLQAMYKAYQSGELDPQVN