Protein Info for Shew_0743 in Shewanella loihica PV-4

Annotation: sodium:dicarboxylate symporter (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 433 transmembrane" amino acids 20 to 41 (22 residues), see Phobius details amino acids 53 to 74 (22 residues), see Phobius details amino acids 91 to 112 (22 residues), see Phobius details amino acids 152 to 173 (22 residues), see Phobius details amino acids 197 to 215 (19 residues), see Phobius details amino acids 226 to 251 (26 residues), see Phobius details amino acids 334 to 353 (20 residues), see Phobius details amino acids 359 to 381 (23 residues), see Phobius details PF00375: SDF" amino acids 22 to 407 (386 residues), 467.1 bits, see alignment E=2.5e-144

Best Hits

Swiss-Prot: 39% identical to GLTT_BACSU: Proton/sodium-glutamate symport protein (gltT) from Bacillus subtilis (strain 168)

KEGG orthology group: None (inferred from 100% identity to slo:Shew_0743)

Predicted SEED Role

"Sodium/glutamate symport protein" in subsystem ZZ gjo need homes

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QAW7 at UniProt or InterPro

Protein Sequence (433 amino acids)

>Shew_0743 sodium:dicarboxylate symporter (RefSeq) (Shewanella loihica PV-4)
MMRQQTSSWLGRAWSGWMSVPLWLQILIGMLLGICAGLGLGEQAVLLKPIGTLFVNTIKM
LIVPLVFCSLIVGVTSMQDTAKMGRIGFKSFAFYLGTTSIAITLGLAVGHIMQPGAGLAM
TSAESHNAVKEVPSIMETLINIVPTNPIAALASGQILQVIVFAVALGIALVLIGDHGKPA
IKVFESLAEAMYKLTDMVMKLAPYGVFGLMAWVAGEYGMDMLMPLIKVILAVYIGCALHI
IGFYSLVLTFVAKLNPMQFFKGISNALAVAYTTSSSAGTLPASMKCASESLGINKKISSF
VLPLGTTINMDGTALYQGVTALFVAQAFGIDLTWVDYITIILTATLASIGTAGVPGAGLV
MLTLVLTTVGLPLEGVAIIAGIDRILDMARTVVNVSGDLVATTVIAKSEDELDLEHYNAD
AEQSQILAERLDS