Protein Info for Shew_0726 in Shewanella loihica PV-4

Annotation: two component, sigma54 specific, Fis family transcriptional regulator (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 494 PF00072: Response_reg" amino acids 4 to 118 (115 residues), 68.2 bits, see alignment E=1.7e-22 PF00158: Sigma54_activat" amino acids 155 to 319 (165 residues), 223.3 bits, see alignment E=3.9e-70 PF14532: Sigma54_activ_2" amino acids 169 to 324 (156 residues), 53.3 bits, see alignment E=9.9e-18 PF25601: AAA_lid_14" amino acids 326 to 386 (61 residues), 56.2 bits, see alignment E=6.3e-19 PF02954: HTH_8" amino acids 458 to 490 (33 residues), 36.7 bits, see alignment (E = 7e-13)

Best Hits

KEGG orthology group: None (inferred from 100% identity to slo:Shew_0726)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QAV0 at UniProt or InterPro

Protein Sequence (494 amino acids)

>Shew_0726 two component, sigma54 specific, Fis family transcriptional regulator (RefSeq) (Shewanella loihica PV-4)
MDTILIVDDNQAVCSALSLMLELNGFKTLTCFSPEEALGLVAEQEIALVIQDMNFTQDTT
SGEEGKRLFYDIRACQPQLPIILLTAWTQLELAVELVKEGAADYMGKPWDDDKLLNSVNN
LISLHALSRQNSQLARSEHQRMSAIKDADLCGIVFGSGAMQRCIDLALQIAKSDVSVLIT
GPNGAGKDKLADILHANSPLKHKPFIKVNIGALPMELLEAELFGAEAGAFTGANKARIGR
FEAADGGTLFLDEIGNLPLSGQVKLLRVLQTGEFERLGSHQTRKVKVRVISATNADLAED
IASGRFREDLFYRLNVIELALPPLNQRQDDILPLVNHFIGQDFSLSKPTQQALVSYPWPG
NVRELENACKRAVILAASPMLTMADFGLKPVNGLKPVSGLNPVSGAPSTSSVSAPSPVAS
QQAQEQRQKPRFAEQEVETDRAPTVDSASRGEPTGADIELALAEHNGVIARVAKSLGLSR
QALYRRMEKFGIEK