Protein Info for Shew_0717 in Shewanella loihica PV-4

Annotation: cobyric acid synthase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 534 PF01656: CbiA" amino acids 30 to 261 (232 residues), 87.5 bits, see alignment E=1.1e-28 TIGR00313: cobyric acid synthase CobQ" amino acids 30 to 516 (487 residues), 476.5 bits, see alignment E=4.9e-147 PF13500: AAA_26" amino acids 30 to 261 (232 residues), 62.1 bits, see alignment E=1e-20 PF07685: GATase_3" amino acids 281 to 475 (195 residues), 193.4 bits, see alignment E=5e-61

Best Hits

Swiss-Prot: 64% identical to COBQ_SHEAM: Cobyric acid synthase (cobQ) from Shewanella amazonensis (strain ATCC BAA-1098 / SB2B)

KEGG orthology group: K02232, adenosylcobyric acid synthase [EC: 6.3.5.10] (inferred from 100% identity to slo:Shew_0717)

Predicted SEED Role

"Cobyric acid synthase (EC 6.3.5.10)" (EC 6.3.5.10)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.5.10

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QAU1 at UniProt or InterPro

Protein Sequence (534 amino acids)

>Shew_0717 cobyric acid synthase (RefSeq) (Shewanella loihica PV-4)
MTPDNLSNQCNPSKQGEQGNSNQEASGNILMVQGTTSDAGKSTLVAGLCRYFAREGRRVA
PFKPQNMALNSAVTLDGGEIGRAQALQAEACYLAPHTDFNPILLKPNSDTSSQVIVQGKA
LSHMEAQTYFGKDSQGYRTKAMAAVLDSLSRLEQQYELILVEGAGSPAEINLREGDIANM
GFAEAVDCPVILIADIDKGGVFAHIVGTLALLSASEQARVKGVVINRFRGDISLLKPGLD
WLEASIDKPVLGVLPYLNDLHLEAEDALDARQVSSGNTRFRVLVLVFPRISNHTDFDPLR
LHPDIDFRYQQVNEAYDGQAIDADLIILPGSKSVRQDLATMVEQGWDRALKRHLRYGGKV
IGICGGYQMLGLAIEDPQGVEGEAGDSDGLGLLPIVTELTPNKRLAQVKGTIKLVGESAS
IAGYEIHCGRSTLLSKATKPLTLTSDEGNQFNEGCLSHDGQILGSYLHGLFDSPEACALL
LGWAGLSSAAAVDPDAIKQAQLDRLADTLAEHLDMARLSAILVETPLRRPNKNN