Protein Info for Shew_0663 in Shewanella loihica PV-4

Annotation: oxidoreductase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 75 91 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details transmembrane" amino acids 57 to 81 (25 residues), see Phobius details PF12769: PNTB_4TM" amino acids 7 to 90 (84 residues), 119 bits, see alignment E=5.1e-39

Best Hits

KEGG orthology group: K00324, NAD(P) transhydrogenase subunit alpha [EC: 1.6.1.2] (inferred from 94% identity to shl:Shal_3545)

Predicted SEED Role

"NAD(P) transhydrogenase alpha subunit (EC 1.6.1.2)" in subsystem Phosphate metabolism (EC 1.6.1.2)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.6.1.2

Use Curated BLAST to search for 1.6.1.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QAN7 at UniProt or InterPro

Protein Sequence (91 amino acids)

>Shew_0663 oxidoreductase (RefSeq) (Shewanella loihica PV-4)
MEILLLLTLFVVAVFLGVELITKVPPTLHTPLMSGSNAISGISLVGALLAAGSGAGLWVN
VLGFIAVVLATINVVGGYMVTNRMLAMFKRK