Protein Info for Shew_0659 in Shewanella loihica PV-4

Annotation: bifunctional heptose 7-phosphate kinase/heptose 1-phosphate adenyltransferase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 476 TIGR02198: bifunctional protein RfaE, domain I" amino acids 6 to 312 (307 residues), 415 bits, see alignment E=2.8e-128 PF00294: PfkB" amino acids 11 to 302 (292 residues), 148.2 bits, see alignment E=5.2e-47 PF08543: Phos_pyr_kin" amino acids 188 to 288 (101 residues), 30.2 bits, see alignment E=4.5e-11 TIGR02199: bifunctional protein RfaE, domain II" amino acids 333 to 472 (140 residues), 202 bits, see alignment E=5.7e-64 TIGR00125: cytidyltransferase-like domain" amino acids 343 to 409 (67 residues), 60.2 bits, see alignment E=2.6e-20 PF01467: CTP_transf_like" amino acids 345 to 470 (126 residues), 69.3 bits, see alignment E=5.8e-23

Best Hits

Swiss-Prot: 100% identical to HLDE_SHELP: Bifunctional protein HldE (hldE) from Shewanella loihica (strain ATCC BAA-1088 / PV-4)

KEGG orthology group: K03272, D-beta-D-heptose 7-phosphate kinase / D-beta-D-heptose 1-phosphate adenosyltransferase [EC: 2.7.1.- 2.7.7.-] (inferred from 100% identity to slo:Shew_0659)

Predicted SEED Role

"ADP-heptose synthase (EC 2.7.-.-) / D-glycero-beta-D-manno-heptose 7-phosphate kinase" in subsystem LOS core oligosaccharide biosynthesis (EC 2.7.-.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.1.-, 2.7.7.-

Use Curated BLAST to search for 2.7.-.- or 2.7.1.- or 2.7.7.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QAN3 at UniProt or InterPro

Protein Sequence (476 amino acids)

>Shew_0659 bifunctional heptose 7-phosphate kinase/heptose 1-phosphate adenyltransferase (RefSeq) (Shewanella loihica PV-4)
MKISLPAFEKANVLVVGDVMLDRYWSGPTGRISPEAPVPVVRVNQIEDRPGGAANVALNI
ATLGGQVSLAGIVGEDETAAALTQGIEALGVVPKWHTVAELPTITKLRVMSRNQQLIRLD
FEEAYPAEQSLALLASAEKELDKVAVVVLSDYAKGAIDKPEAFIAKAKAKGVKVLVDPKG
SDFSRYRGATLLTPNMSEFEQVVGKVADEADLVTKAKELLKEFDFEALLVTRSEKGMTLI
TADAPELHIPTVAHEVYDVTGAGDTVISALATSLAVGCELPVACALANTAAGIVVGKLGT
STVSRIELIAALNLSHGESGYGVVSEDQLAYALEQAKLKGERVVMTNGCFDILHAGHVSY
LQQARALGDRLIVAVNDDDSVKRLKGDGRPVNKLDRRMAVLAGLASVDWVVPFSEDTPQR
IISRLLPNKLVKGGDYNVEDIAGGKEVIAAGGSVEVLGFEDGVSTTAIIENIMAKQ